BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_F_E22 (803 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_32794| Best HMM Match : Gam (HMM E-Value=5.8) 30 1.9 SB_21193| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.9 SB_14816| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.3 >SB_32794| Best HMM Match : Gam (HMM E-Value=5.8) Length = 511 Score = 30.3 bits (65), Expect = 1.9 Identities = 12/31 (38%), Positives = 20/31 (64%) Frame = -1 Query: 527 VQSDSLQCPNGNLLLTPLD*HLIFQPWSRVK 435 ++SDSL+CP+ N L+ D +F W+ +K Sbjct: 469 MESDSLECPSHNELIHNEDKEEVFDEWNLIK 499 >SB_21193| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 362 Score = 30.3 bits (65), Expect = 1.9 Identities = 12/31 (38%), Positives = 20/31 (64%) Frame = -1 Query: 527 VQSDSLQCPNGNLLLTPLD*HLIFQPWSRVK 435 ++SDSL+CP+ N L+ D +F W+ +K Sbjct: 279 MESDSLECPSHNELIHNEDKEEVFDEWNLIK 309 >SB_14816| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3760 Score = 29.5 bits (63), Expect = 3.3 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = +2 Query: 110 NKIFSDFQKNLDQEQELRETIRTICKEVDQISRE 211 N + N ++ Q+LRE ICKE +Q+ RE Sbjct: 1299 NTSLEEKDNNEEEVQQLREWYDVICKEKEQLERE 1332 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,117,811 Number of Sequences: 59808 Number of extensions: 475719 Number of successful extensions: 1344 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1234 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1344 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2227723674 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -