BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_F_E21 (817 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. 23 4.5 DQ058012-1|AAY57281.1| 373|Apis mellifera venom allergen acid p... 23 4.5 AY939855-1|AAX33235.1| 388|Apis mellifera venom acid phosphatas... 23 4.5 AF205594-1|AAQ13840.1| 156|Apis mellifera acid phosphatase prec... 23 4.5 EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage prot... 22 5.9 DQ667194-1|ABG75746.1| 391|Apis mellifera cys-loop ligand-gated... 22 7.8 >DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. Length = 828 Score = 22.6 bits (46), Expect = 4.5 Identities = 7/11 (63%), Positives = 9/11 (81%) Frame = +3 Query: 282 KWFFPRWAQAL 314 K+FFP+W Q L Sbjct: 648 KFFFPKWLQVL 658 >DQ058012-1|AAY57281.1| 373|Apis mellifera venom allergen acid phosphatase protein. Length = 373 Score = 22.6 bits (46), Expect = 4.5 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = -3 Query: 71 GSLRLKIIFTYHITDTTP 18 G L +FTY+IT++TP Sbjct: 202 GELFDATVFTYNITNSTP 219 >AY939855-1|AAX33235.1| 388|Apis mellifera venom acid phosphatase precursor protein. Length = 388 Score = 22.6 bits (46), Expect = 4.5 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = -3 Query: 71 GSLRLKIIFTYHITDTTP 18 G L +FTY+IT++TP Sbjct: 217 GELFDATVFTYNITNSTP 234 >AF205594-1|AAQ13840.1| 156|Apis mellifera acid phosphatase precursor protein. Length = 156 Score = 22.6 bits (46), Expect = 4.5 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = -3 Query: 71 GSLRLKIIFTYHITDTTP 18 G L +FTY+IT++TP Sbjct: 105 GELFDATVFTYNITNSTP 122 >EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage protein protein. Length = 1010 Score = 22.2 bits (45), Expect = 5.9 Identities = 17/66 (25%), Positives = 26/66 (39%) Frame = +3 Query: 492 VVTVQGVPLSSYMEDLLTNKISLNAGKGRQAIEWVIGKFDTEIKELASSACKSTDELLSQ 671 V+T QGV LS Y + L G GR G ++L +A + + Sbjct: 359 VITPQGVFLSLYQPQGMNILGDLIEGTGRSVNPRYYGSLQAAARKLLGNA-PEVENIWDY 417 Query: 672 TKKSID 689 T S++ Sbjct: 418 TPSSLE 423 >DQ667194-1|ABG75746.1| 391|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 391 Score = 21.8 bits (44), Expect = 7.8 Identities = 7/20 (35%), Positives = 14/20 (70%) Frame = +1 Query: 628 LQVQPVKVQMNYYHKQRSQL 687 +Q+ P+ ++ YHKQ+ +L Sbjct: 127 IQICPIYIESFSYHKQKLRL 146 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 223,393 Number of Sequences: 438 Number of extensions: 4967 Number of successful extensions: 16 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 25974678 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -