BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_F_E18 (689 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_01_0133 - 1057679-1057880,1058112-1058377 30 2.0 03_06_0040 + 31240164-31241102,31241280-31241897 28 6.1 10_08_0508 - 18416688-18416795,18417058-18417477 28 8.0 >03_01_0133 - 1057679-1057880,1058112-1058377 Length = 155 Score = 29.9 bits (64), Expect = 2.0 Identities = 15/32 (46%), Positives = 18/32 (56%), Gaps = 2/32 (6%) Frame = -2 Query: 454 CTQ--RLSWPCRSKQPKMRGLEPNQRLPSTLR 365 CT+ RL WPCR QP +GL P R L+ Sbjct: 64 CTRGARLGWPCR--QPNTKGLHPWMRASELLK 93 >03_06_0040 + 31240164-31241102,31241280-31241897 Length = 518 Score = 28.3 bits (60), Expect = 6.1 Identities = 14/34 (41%), Positives = 24/34 (70%), Gaps = 1/34 (2%) Frame = +1 Query: 463 PDSLSEERQKAQ-LQRMLDLKVNPIDGLASKWDY 561 PD+ ++ +AQ L+ +LD ++NP+ G A+ WDY Sbjct: 202 PDADTDMSMEAQELRHVLD-ELNPLIGAANLWDY 234 >10_08_0508 - 18416688-18416795,18417058-18417477 Length = 175 Score = 27.9 bits (59), Expect = 8.0 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = +3 Query: 168 WFQRPAQLRXQA*LPPACHPVP*GHP 245 W + A+ R + LP CHPVP G P Sbjct: 92 WIETAARQRGKLRLPKQCHPVP-GSP 116 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,425,959 Number of Sequences: 37544 Number of extensions: 415793 Number of successful extensions: 1053 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1026 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1052 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1756684372 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -