BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_F_E13 (832 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439353-12|CAD27934.1| 160|Anopheles gambiae putative MLC1 pro... 66 9e-13 AY193729-1|AAO62002.1| 499|Anopheles gambiae cytochrome P450 CY... 25 2.1 AY056833-1|AAL23627.1| 1253|Anopheles gambiae chitin synthase pr... 25 3.7 AY324315-1|AAQ89700.1| 153|Anopheles gambiae insulin-like pepti... 23 8.6 >AJ439353-12|CAD27934.1| 160|Anopheles gambiae putative MLC1 protein protein. Length = 160 Score = 66.5 bits (155), Expect = 9e-13 Identities = 39/133 (29%), Positives = 63/133 (47%), Gaps = 4/133 (3%) Frame = +1 Query: 277 FDLFDTENTGKIDTKELKVAIRALGFEPXXXXXXXXXXXXXXGDGKVSFDDFMELMSVKM 456 F ++D E +G++D +L A+RAL P G+ K+ F++F+ + S Sbjct: 17 FSVYDWEGSGQMDAMDLGNALRALNLNPTIELIGKMGGTQKRGEKKIKFEEFLPIFSQVK 76 Query: 457 AEKDTR--EEIMKAFKLFDDDETGKISFKNLKRVAKELGENLTDEELHEMIDEA--DRDG 624 EK+ E+ ++ KL+D +E G + L LGE L D EL ++ + D Sbjct: 77 KEKEQGCFEDFLECLKLYDKNEDGTMLLAELTHSLTALGERLDDVELDNVMKDCMDPEDD 136 Query: 625 DGEINQEEFLRIM 663 DG I FL+ M Sbjct: 137 DGNIPYAPFLKKM 149 >AY193729-1|AAO62002.1| 499|Anopheles gambiae cytochrome P450 CYPm3r9 protein. Length = 499 Score = 25.4 bits (53), Expect = 2.1 Identities = 17/52 (32%), Positives = 23/52 (44%) Frame = +1 Query: 436 ELMSVKMAEKDTREEIMKAFKLFDDDETGKISFKNLKRVAKELGENLTDEEL 591 EL+ T+E I FK DD GK F + + K + +TD EL Sbjct: 40 ELLFGNFGSIGTKEHITVPFKRIYDDNKGKHPFAGMYQFVKPVA-LITDLEL 90 >AY056833-1|AAL23627.1| 1253|Anopheles gambiae chitin synthase protein. Length = 1253 Score = 24.6 bits (51), Expect = 3.7 Identities = 10/41 (24%), Positives = 22/41 (53%) Frame = -2 Query: 675 TSLFHDTQEFLLIYFTIPISISFIYHFMQFFICEVFTKFLC 553 +S+ D +E + + I + + H + ++C +F+KF C Sbjct: 13 SSITSDLEEHEIFPTSNAIIWTTVTHILCAYLCYIFSKFAC 53 >AY324315-1|AAQ89700.1| 153|Anopheles gambiae insulin-like peptide 7 precursor protein. Length = 153 Score = 23.4 bits (48), Expect = 8.6 Identities = 8/30 (26%), Positives = 17/30 (56%) Frame = +1 Query: 532 FKNLKRVAKELGENLTDEELHEMIDEADRD 621 F ++ ++ + L E H+++DE +RD Sbjct: 64 FNGFRKKSENVLMTLAGPETHQLLDELERD 93 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 768,130 Number of Sequences: 2352 Number of extensions: 14629 Number of successful extensions: 27 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 26 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 27 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 87651612 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -