BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_F_E13 (832 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667182-1|ABG75734.1| 445|Apis mellifera GABA-gated chloride c... 23 4.6 DQ667181-1|ABG75733.1| 445|Apis mellifera GABA-gated chloride c... 23 4.6 AF094822-1|AAC63381.1| 365|Apis mellifera GABA receptor Rdl sub... 23 4.6 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 22 6.0 >DQ667182-1|ABG75734.1| 445|Apis mellifera GABA-gated chloride channel protein. Length = 445 Score = 22.6 bits (46), Expect = 4.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 178 KTATTNPGPGGV 213 KTA NPGP GV Sbjct: 326 KTARENPGPPGV 337 >DQ667181-1|ABG75733.1| 445|Apis mellifera GABA-gated chloride channel protein. Length = 445 Score = 22.6 bits (46), Expect = 4.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 178 KTATTNPGPGGV 213 KTA NPGP GV Sbjct: 326 KTARENPGPPGV 337 >AF094822-1|AAC63381.1| 365|Apis mellifera GABA receptor Rdl subunit protein. Length = 365 Score = 22.6 bits (46), Expect = 4.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 178 KTATTNPGPGGV 213 KTA NPGP GV Sbjct: 265 KTARENPGPPGV 276 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 22.2 bits (45), Expect = 6.0 Identities = 9/36 (25%), Positives = 21/36 (58%) Frame = -3 Query: 521 PVSSSSNSLNAFMISSLVSFSAIFTDMSSIKSSNDT 414 P+S+++ + + + + S I+T + I SS++T Sbjct: 1106 PLSAANGVITGYKVIVIPSGGGIYTKDTKITSSSET 1141 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 209,219 Number of Sequences: 438 Number of extensions: 4063 Number of successful extensions: 6 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 26581563 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -