BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_F_E11 (596 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g35800.1 68417.m05087 DNA-directed RNA polymerase II largest ... 34 0.063 At1g80490.2 68414.m09430 WD-40 repeat family protein contains 9 ... 31 0.77 At1g80490.1 68414.m09429 WD-40 repeat family protein contains 9 ... 31 0.77 At3g61260.1 68416.m06856 DNA-binding family protein / remorin fa... 30 1.0 At3g25950.1 68416.m03234 hypothetical protein 29 3.1 At4g00200.1 68417.m00021 DNA-binding family protein contains a A... 27 7.2 At1g15750.2 68414.m01890 WD-40 repeat family protein contains 10... 27 7.2 At1g15750.1 68414.m01889 WD-40 repeat family protein contains 10... 27 7.2 At5g58160.1 68418.m07280 formin homology 2 domain-containing pro... 27 9.5 At5g23230.1 68418.m02717 isochorismatase hydrolase family protei... 27 9.5 At3g51340.1 68416.m05620 aspartyl protease family protein contai... 27 9.5 At3g07250.1 68416.m00863 nuclear transport factor 2 (NTF2) famil... 27 9.5 At2g04780.2 68415.m00489 fasciclin-like arabinogalactan-protein ... 27 9.5 At2g04780.1 68415.m00488 fasciclin-like arabinogalactan-protein ... 27 9.5 At1g11160.1 68414.m01278 WD-40 repeat family protein / katanin p... 27 9.5 >At4g35800.1 68417.m05087 DNA-directed RNA polymerase II largest subunit (RPB205) (RPII) (RPB1) nearly identical to P|P18616 DNA-directed RNA polymerase II largest subunit (EC 2.7.7.6) {Arabidopsis thaliana} Length = 1840 Score = 34.3 bits (75), Expect = 0.063 Identities = 22/58 (37%), Positives = 30/58 (51%), Gaps = 4/58 (6%) Frame = +2 Query: 275 SSGY--TAPDGTPIQITYTADANGYQP-SGAHLPTTPAPLPI-PDYIARAIEYIRTHP 436 S GY T+P +P TY+ + GY P S A+ PT+P+ P P Y + Y T P Sbjct: 1563 SPGYSPTSPGYSPTSPTYSPSSPGYSPTSPAYSPTSPSYSPTSPSYSPTSPSYSPTSP 1620 >At1g80490.2 68414.m09430 WD-40 repeat family protein contains 9 WD-40 repeats domain (PF00400) (6 weak) Length = 1120 Score = 30.7 bits (66), Expect = 0.77 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = +2 Query: 332 ANGYQPSGAHLPTTPAPLPIPDYIA 406 A G+ P GAH P P P P+P +A Sbjct: 227 AEGFPPLGAHGPFQPTPSPVPTPLA 251 >At1g80490.1 68414.m09429 WD-40 repeat family protein contains 9 WD-40 repeats domain (PF00400) (6 weak) Length = 1120 Score = 30.7 bits (66), Expect = 0.77 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = +2 Query: 332 ANGYQPSGAHLPTTPAPLPIPDYIA 406 A G+ P GAH P P P P+P +A Sbjct: 227 AEGFPPLGAHGPFQPTPSPVPTPLA 251 >At3g61260.1 68416.m06856 DNA-binding family protein / remorin family protein similar to DNA-binding protein gi|601843 [Arabidopsis thaliana], remorin [Solanum tuberosum] GI:1881585; contains Pfam profiles PF03763: Remorin C-terminal region, PF03766: Remorin N-terminal region Length = 212 Score = 30.3 bits (65), Expect = 1.0 Identities = 15/49 (30%), Positives = 25/49 (51%) Frame = +2 Query: 302 TPIQITYTADANGYQPSGAHLPTTPAPLPIPDYIARAIEYIRTHPPKPE 448 +P ++T A A+ P+ A +P PAP P P + + + + P PE Sbjct: 13 SPAKVTTPAPADTPAPAPAEIPA-PAPAPTPADVTKDVAEEKIQNPPPE 60 >At3g25950.1 68416.m03234 hypothetical protein Length = 251 Score = 28.7 bits (61), Expect = 3.1 Identities = 16/34 (47%), Positives = 18/34 (52%) Frame = -3 Query: 444 GLGG*VLMYSMARAM*SGIGRGAGVVGRWAPEGW 343 GL G V++Y MA G G GVV RWA W Sbjct: 187 GLAGPVVLYDMATFY--GSGAADGVVPRWAWLSW 218 >At4g00200.1 68417.m00021 DNA-binding family protein contains a AT hook motif (DNA binding motifs with a preference for A/T rich regions), Pfam:PF02178 Length = 345 Score = 27.5 bits (58), Expect = 7.2 Identities = 22/88 (25%), Positives = 38/88 (43%), Gaps = 3/88 (3%) Frame = +2 Query: 191 QTSN-GISGQEQGVLVNEGREDASIAVQGSSGYTAPDGTPIQITYTADANGYQPSGAHLP 367 +T N G G+ G+ V+ D + G +G TPIQ+T+ ++ N Y G+ + Sbjct: 209 ETENQGSKGRSGGMSVSLAGPDGRVVGGGVAGLLIA-ATPIQVTHESNNNVYVVVGSFIT 267 Query: 368 TTPA--PLPIPDYIARAIEYIRTHPPKP 445 + P + A + + PP P Sbjct: 268 SDQQDHQKPRKQRVEHAPAAVMSVPPPP 295 >At1g15750.2 68414.m01890 WD-40 repeat family protein contains 10 WD-40 repeats (PF00400) (1 weak) Length = 1131 Score = 27.5 bits (58), Expect = 7.2 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +2 Query: 332 ANGYQPSGAHLPTTPAPLPIPDYIA 406 A G+ P GAH P P P+P +A Sbjct: 227 AGGFPPLGAHGPFQPTASPVPTPLA 251 >At1g15750.1 68414.m01889 WD-40 repeat family protein contains 10 WD-40 repeats (PF00400) (1 weak) Length = 1131 Score = 27.5 bits (58), Expect = 7.2 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +2 Query: 332 ANGYQPSGAHLPTTPAPLPIPDYIA 406 A G+ P GAH P P P+P +A Sbjct: 227 AGGFPPLGAHGPFQPTASPVPTPLA 251 >At5g58160.1 68418.m07280 formin homology 2 domain-containing protein / FH2 domain-containing protein low similarity to SP|Q05858 Formin (Limb deformity protein) {Gallus gallus}; contains Pfam profile PF02181: Formin Homology 2(FH2) Domain Length = 1307 Score = 27.1 bits (57), Expect = 9.5 Identities = 20/64 (31%), Positives = 25/64 (39%) Frame = +2 Query: 266 VQGSSGYTAPDGTPIQITYTADANGYQPSGAHLPTTPAPLPIPDYIARAIEYIRTHPPKP 445 V SS P P T +NG + P PAP +P + A T PP P Sbjct: 722 VHTSSPPPPPPPPPPPAPPTPQSNGISAMKSSPPAPPAPPRLPTHSASPPP--PTAPPPP 779 Query: 446 EVGQ 457 +GQ Sbjct: 780 PLGQ 783 >At5g23230.1 68418.m02717 isochorismatase hydrolase family protein low similarity to SP|P45743 Isochorismatase (EC 3.3.2.1) (2,3 dihydro-2,3 dihydroxybenzoate synthase) (Superoxide-inducible protein 1) (SOI1) {Bacillus subtilis}; contains Pfam profile PF00857: isochorismatase family protein Length = 198 Score = 27.1 bits (57), Expect = 9.5 Identities = 17/60 (28%), Positives = 31/60 (51%), Gaps = 1/60 (1%) Frame = +2 Query: 161 VFPDKYQYQYQTSNGISGQE-QGVLVNEGREDASIAVQGSSGYTAPDGTPIQITYTADAN 337 VF ++ ++ T +G+ G+ G L+ +G D+ I + + T PD + TY+A N Sbjct: 57 VFFTRHNHKSPTDHGMLGEWWNGDLILDGTTDSEIIPEINRQVTGPDEIVEKSTYSAFNN 116 >At3g51340.1 68416.m05620 aspartyl protease family protein contains Eukaryotic and viral aspartyl proteases active site, PROSITE:PS00141 Length = 518 Score = 27.1 bits (57), Expect = 9.5 Identities = 12/40 (30%), Positives = 19/40 (47%) Frame = +2 Query: 272 GSSGYTAPDGTPIQITYTADANGYQPSGAHLPTTPAPLPI 391 G GYT + TP+ T+ A G +G + P +P+ Sbjct: 273 GDKGYTDQEETPLVSLETSTAYGVNVTGVSVGGVPVDVPL 312 >At3g07250.1 68416.m00863 nuclear transport factor 2 (NTF2) family protein / RNA recognition motif (RRM)-containing protein contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain), PF02136: Nuclear transport factor 2 (NTF2) domain Length = 1294 Score = 27.1 bits (57), Expect = 9.5 Identities = 17/63 (26%), Positives = 28/63 (44%) Frame = +2 Query: 179 QYQYQTSNGISGQEQGVLVNEGREDASIAVQGSSGYTAPDGTPIQITYTADANGYQPSGA 358 Q + +N ++G EQ V +G +DA +S T G P + ++ NG A Sbjct: 159 QVRSPVNNILTGTEQTVHNTDGSKDAETQEWSNSSVTKESGKPPKPHTNSNGNGSLLPFA 218 Query: 359 HLP 367 +P Sbjct: 219 QMP 221 >At2g04780.2 68415.m00489 fasciclin-like arabinogalactan-protein (FLA7) identical to gi_13377782_gb_AAK20860 Length = 254 Score = 27.1 bits (57), Expect = 9.5 Identities = 12/30 (40%), Positives = 15/30 (50%) Frame = +2 Query: 314 ITYTADANGYQPSGAHLPTTPAPLPIPDYI 403 I +A A P LP TPAP P P+ + Sbjct: 16 IVCSASAKTASPPAPVLPPTPAPAPAPENV 45 >At2g04780.1 68415.m00488 fasciclin-like arabinogalactan-protein (FLA7) identical to gi_13377782_gb_AAK20860 Length = 254 Score = 27.1 bits (57), Expect = 9.5 Identities = 12/30 (40%), Positives = 15/30 (50%) Frame = +2 Query: 314 ITYTADANGYQPSGAHLPTTPAPLPIPDYI 403 I +A A P LP TPAP P P+ + Sbjct: 16 IVCSASAKTASPPAPVLPPTPAPAPAPENV 45 >At1g11160.1 68414.m01278 WD-40 repeat family protein / katanin p80 subunit, putative similar to contains 6 WD-40 repeats (PF00400); katanin p80 subunit (GI:3005601) [Strongylocentrotus purpuratus] Length = 974 Score = 27.1 bits (57), Expect = 9.5 Identities = 13/41 (31%), Positives = 20/41 (48%) Frame = +3 Query: 168 RTNTSTNIRPATESVARNKECS*TRAVRMHPSPSKVQAATL 290 R N++ +RP S A + EC T + SP++V L Sbjct: 692 RRNSAARVRPVLLSQATSHECPVTSVRPLRTSPARVMPTKL 732 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,162,782 Number of Sequences: 28952 Number of extensions: 253921 Number of successful extensions: 891 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 758 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 891 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1190791976 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -