BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_F_E08 (500 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 23 2.4 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 22 3.1 DQ468657-1|ABE02558.1| 322|Apis mellifera 1,4,5-trisphosphate r... 21 5.5 DQ325076-1|ABD14090.1| 191|Apis mellifera complementary sex det... 21 5.5 AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. 21 9.5 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 22.6 bits (46), Expect = 2.4 Identities = 13/45 (28%), Positives = 17/45 (37%) Frame = +3 Query: 150 LTTARTSLILPKTTTLMETATNLSTTVHITWTVPKADLTSSLPLS 284 +TT T+ TTT T N + T P+ D LS Sbjct: 658 ITTITTTTTTTTTTTTTTTTPNTTQNASATTPPPQVDEVDDKELS 702 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 22.2 bits (45), Expect = 3.1 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = +1 Query: 229 CILRGPSPRPTLLQA 273 C+LR +P P +L+A Sbjct: 1106 CVLRASTPAPVVLEA 1120 >DQ468657-1|ABE02558.1| 322|Apis mellifera 1,4,5-trisphosphate receptor protein. Length = 322 Score = 21.4 bits (43), Expect = 5.5 Identities = 8/26 (30%), Positives = 15/26 (57%) Frame = +1 Query: 244 PSPRPTLLQAYPFPWCSRWEVKNILE 321 P P+P L + YP ++ ++ IL+ Sbjct: 31 PRPKPLLKKEYPLVMDTKLKIIEILQ 56 >DQ325076-1|ABD14090.1| 191|Apis mellifera complementary sex determiner protein. Length = 191 Score = 21.4 bits (43), Expect = 5.5 Identities = 14/54 (25%), Positives = 22/54 (40%) Frame = +2 Query: 119 LISNRNGYEPIDNRPYIVNPPKDYNPNGNGYEPIDNGAYYVDRPQGRPYFKPTP 280 +IS+ + +N Y N +YN N N Y Y ++ + P P P Sbjct: 81 IISSLSNKTIHNNNNYNNNNYNNYNYNNNNYNNYKKLYYNINYIEQIPVPVPVP 134 >AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. Length = 429 Score = 20.6 bits (41), Expect = 9.5 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +2 Query: 191 NPNGNGYEPIDNGAYYVDRP 250 N GN + D+GA DRP Sbjct: 254 NAAGNNEDSSDSGAAASDRP 273 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 121,297 Number of Sequences: 438 Number of extensions: 3081 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 13741392 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -