BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_F_E07 (730 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ223627-1|CAA11500.1| 371|Tribolium castaneum orthodenticle-1 ... 24 1.1 U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. 23 1.9 X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. 22 4.4 AJ606487-1|CAE55183.1| 203|Tribolium castaneum Giant protein pr... 22 4.4 DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 22 5.8 >AJ223627-1|CAA11500.1| 371|Tribolium castaneum orthodenticle-1 protein protein. Length = 371 Score = 24.2 bits (50), Expect = 1.1 Identities = 11/27 (40%), Positives = 15/27 (55%), Gaps = 1/27 (3%) Frame = -1 Query: 718 PXFEPLV-RHEIHSTGWCISQYGSNTS 641 P PL +HE +S W + +G NTS Sbjct: 270 PSASPLAYQHEYNSFNWTANGHGHNTS 296 >U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. Length = 425 Score = 23.4 bits (48), Expect = 1.9 Identities = 30/109 (27%), Positives = 46/109 (42%), Gaps = 7/109 (6%) Frame = -2 Query: 522 SPGAIMDVVNIPENAPAA-----KSSAFVRTCSSSFFMSFLPRPKPKKLMANIGATPVRG 358 SP ++ PE AP A + + + +S M+ P P +A I Sbjct: 79 SPEPDPEIPVAPEPAPLASPLVQEPGSSTTSATSGAVMASPPMPITTDNVAAISGVLRSL 138 Query: 357 ADMPL*SPRKPSF*TVFLKQSQVPAYRATSPGFGR--GIVCNRTLIVSI 217 D PL +P +PSF +Q+ V RA +GR G+ R L V++ Sbjct: 139 LDRPLPAPERPSF-EGLKRQNPVKFLRAIEE-YGRFFGLDSQRLLGVAM 185 >X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. Length = 524 Score = 22.2 bits (45), Expect = 4.4 Identities = 9/28 (32%), Positives = 13/28 (46%) Frame = +1 Query: 493 IYDVHNGARRTYQMFITNTTGW*CSSKI 576 +Y +H G + F N G CS K+ Sbjct: 485 LYTIHMGYHGFHNPFTCNMCGVECSDKV 512 >AJ606487-1|CAE55183.1| 203|Tribolium castaneum Giant protein protein. Length = 203 Score = 22.2 bits (45), Expect = 4.4 Identities = 12/34 (35%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Frame = +3 Query: 243 KLC-PFQNRARSLCTLAPGIVSRKPFKRKASADS 341 K C PF+ + TLA G+VS + +K S+++ Sbjct: 66 KSCRPFKAYIKDPLTLAQGLVSTEMLLKKDSSEA 99 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 21.8 bits (44), Expect = 5.8 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = +2 Query: 407 GLGKKLIKNDEEQVLTKAELFAAGAF 484 G+ + I+ND+E AEL G F Sbjct: 386 GMYQCFIRNDQESAEATAELKLGGRF 411 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 189,102 Number of Sequences: 336 Number of extensions: 4503 Number of successful extensions: 18 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19467635 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -