BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_F_E06 (704 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g66060.1 68418.m08323 oxidoreductase, 2OG-Fe(II) oxygenase fa... 29 2.3 At5g16220.1 68418.m01895 octicosapeptide/Phox/Bem1p (PB1) domain... 29 2.3 At1g20270.1 68414.m02531 oxidoreductase, 2OG-Fe(II) oxygenase fa... 29 3.0 At3g13060.2 68416.m01628 expressed protein contains Pfam profile... 29 4.0 At3g13060.1 68416.m01627 expressed protein contains Pfam profile... 29 4.0 At2g33410.1 68415.m04095 heterogeneous nuclear ribonucleoprotein... 29 4.0 At3g57170.1 68416.m06365 N-acetylglucosaminyl transferase compon... 28 5.2 At5g28120.1 68418.m03396 hypothetical protein 27 9.2 At5g28110.1 68418.m03395 hypothetical protein 27 9.2 At5g18510.1 68418.m02185 hypothetical protein 27 9.2 >At5g66060.1 68418.m08323 oxidoreductase, 2OG-Fe(II) oxygenase family protein similar to prolyl 4-hydroxylase, alpha subunit, from Rattus norvegicus [GI:474940], Mus musculus [SP|Q60715], Homo sapiens [GI:18073925]; contains PF03171 2OG-Fe(II) oxygenase superfamily domain Length = 267 Score = 29.5 bits (63), Expect = 2.3 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +3 Query: 297 HRRLQRARCTYLIVAARPLPIPATYRNKKTKSITLSNQRTRSSAPLKR 440 H L + C YLI A+P +T ++KT T S RT S L R Sbjct: 91 HNFLTKEECKYLIELAKPHMEKSTVVDEKTGKSTDSRVRTSSGTFLAR 138 >At5g16220.1 68418.m01895 octicosapeptide/Phox/Bem1p (PB1) domain-containing protein hypothetical proteins - Arabidopsis thaliana contains Pfam profile PF00564: PB1 domain Length = 476 Score = 29.5 bits (63), Expect = 2.3 Identities = 21/57 (36%), Positives = 27/57 (47%), Gaps = 2/57 (3%) Frame = +2 Query: 260 GMAAFMYR-QPEAAQAPSTGQVYIPDRRRQTLADTSYVPQQENEVYYPQQPE-NPIF 424 G FM + Q + Q TGQ YI TL T+Y N VYY + P+ PI+ Sbjct: 317 GYPPFMNQAQQQHIQVIYTGQPYITGNSPMTLPATAY--HHTNHVYYQRPPQPYPIY 371 >At1g20270.1 68414.m02531 oxidoreductase, 2OG-Fe(II) oxygenase family protein similar to prolyl 4-hydroxylase, alpha subunit, from Gallus gallus [GI:212530], Rattus norvegicus [GI:474940], Mus musculus [SP|Q60715]; contains PF03171 2OG-Fe(II) oxygenase superfamily domain Length = 287 Score = 29.1 bits (62), Expect = 3.0 Identities = 16/48 (33%), Positives = 23/48 (47%) Frame = +3 Query: 297 HRRLQRARCTYLIVAARPLPIPATYRNKKTKSITLSNQRTRSSAPLKR 440 H L + C YLI A+P + +T + +T S RT S L+R Sbjct: 89 HNFLSKEECEYLISLAKPHMVKSTVVDSETGKSKDSRVRTSSGTFLRR 136 >At3g13060.2 68416.m01628 expressed protein contains Pfam profile PF04146: YT521-B-like family Length = 634 Score = 28.7 bits (61), Expect = 4.0 Identities = 29/92 (31%), Positives = 38/92 (41%), Gaps = 5/92 (5%) Frame = +2 Query: 152 YGNVDSLSYGS--GDSNRGGLVMSRYYNPYYNPRAVGGGMAAFMYRQPEAAQAPSTGQVY 325 Y NV+ L S G + LV Y YNP+ G + P A+ PS GQ+Y Sbjct: 100 YVNVEGLDITSPVGFNENASLVYQTGYG--YNPQMPYGPYS------PAASPLPSEGQLY 151 Query: 326 IPDRRRQTLADTSY---VPQQENEVYYPQQPE 412 P + + A Y VP + P QPE Sbjct: 152 SPQQFPFSGASPYYQQVVPPSMQYITSPTQPE 183 >At3g13060.1 68416.m01627 expressed protein contains Pfam profile PF04146: YT521-B-like family Length = 551 Score = 28.7 bits (61), Expect = 4.0 Identities = 29/92 (31%), Positives = 38/92 (41%), Gaps = 5/92 (5%) Frame = +2 Query: 152 YGNVDSLSYGS--GDSNRGGLVMSRYYNPYYNPRAVGGGMAAFMYRQPEAAQAPSTGQVY 325 Y NV+ L S G + LV Y YNP+ G + P A+ PS GQ+Y Sbjct: 100 YVNVEGLDITSPVGFNENASLVYQTGYG--YNPQMPYGPYS------PAASPLPSEGQLY 151 Query: 326 IPDRRRQTLADTSY---VPQQENEVYYPQQPE 412 P + + A Y VP + P QPE Sbjct: 152 SPQQFPFSGASPYYQQVVPPSMQYITSPTQPE 183 >At2g33410.1 68415.m04095 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative Length = 404 Score = 28.7 bits (61), Expect = 4.0 Identities = 22/61 (36%), Positives = 25/61 (40%), Gaps = 4/61 (6%) Frame = +2 Query: 140 YNPYYGNVDSLSYGSGDSNRGGLVMSRYYN----PYYNPRAVGGGMAAFMYRQPEAAQAP 307 Y PY G+ YG G + G Y N PY NP G G + R AQAP Sbjct: 238 YPPYGGSGYGTGYGYGSNGVGYGGFGGYGNPAGAPYGNPSVPGAGFGSGP-RSSWGAQAP 296 Query: 308 S 310 S Sbjct: 297 S 297 >At3g57170.1 68416.m06365 N-acetylglucosaminyl transferase component family protein / Gpi1 family protein similar to SP|O14357 N-acetylglucosaminyl-phosphatidylinositol biosynthetic protein gpi1 {Schizosaccharomyces pombe}; contains Pfam profile PF05024: N-acetylglucosaminyl transferase component (Gpi1) Length = 560 Score = 28.3 bits (60), Expect = 5.2 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = +3 Query: 390 SITLSNQRTRSSAPLKRPNWLTPL 461 S++ SN ++ APLK+P W+ L Sbjct: 49 SLSFSNSSPQTKAPLKKPKWVDDL 72 >At5g28120.1 68418.m03396 hypothetical protein Length = 506 Score = 27.5 bits (58), Expect = 9.2 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = +2 Query: 149 YYGNVDSLSYGSGDSNRGGLVMSR 220 Y GN+D + +G GD ++ L+ SR Sbjct: 122 YVGNIDRVRWGPGDKDQKTLIKSR 145 >At5g28110.1 68418.m03395 hypothetical protein Length = 493 Score = 27.5 bits (58), Expect = 9.2 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = +2 Query: 149 YYGNVDSLSYGSGDSNRGGLVMSR 220 Y GN+D + +G GD ++ L+ SR Sbjct: 122 YVGNIDRVRWGPGDKDQKTLIKSR 145 >At5g18510.1 68418.m02185 hypothetical protein Length = 702 Score = 27.5 bits (58), Expect = 9.2 Identities = 9/20 (45%), Positives = 15/20 (75%) Frame = +2 Query: 413 NPIFSPTQATELADPTEKIE 472 +P+FSP + +E+ D EK+E Sbjct: 137 SPVFSPLECSEMRDSAEKLE 156 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,894,678 Number of Sequences: 28952 Number of extensions: 292607 Number of successful extensions: 853 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 822 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 853 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1516419560 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -