BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_F_E05 (803 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage prot... 25 1.1 DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholi... 24 1.9 DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholi... 24 1.9 DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholi... 24 1.9 DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholi... 22 5.8 AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 22 7.7 >EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage protein protein. Length = 1010 Score = 24.6 bits (51), Expect = 1.1 Identities = 25/79 (31%), Positives = 37/79 (46%), Gaps = 11/79 (13%) Frame = -2 Query: 718 HLREQHEPHTEALLSSPVLPQRRQEVLDLLKHQPIYRLLQ----------TEGVRFLRSL 569 H + H H + SS Q++Q VL L Q + + +Q +GV+ ++ + Sbjct: 806 HQQSHHGLHINSSPSSVQSGQQQQSVLQGLGVQGVQQGVQGVQTAQGVQGVQGVQGVQGV 865 Query: 568 QGSQGVLRTMQLLQ-VQSV 515 QG QGV LLQ VQ V Sbjct: 866 QGVQGVQGVPGLLQGVQQV 884 >DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 23.8 bits (49), Expect = 1.9 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = -1 Query: 326 LSISTLSGLVLFFLMTLLAFPQPPIITSYIG 234 LSIS L L +FFL+ + P ++ +G Sbjct: 278 LSISILISLHVFFLLVVEIIPPTSLVVPLLG 308 >DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 23.8 bits (49), Expect = 1.9 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = -1 Query: 326 LSISTLSGLVLFFLMTLLAFPQPPIITSYIG 234 LSIS L L +FFL+ + P ++ +G Sbjct: 278 LSISILISLHVFFLLVVEIIPPTSLVVPLLG 308 >DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholine receptor alpha3subunit protein. Length = 566 Score = 23.8 bits (49), Expect = 1.9 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = -1 Query: 326 LSISTLSGLVLFFLMTLLAFPQPPIITSYIG 234 LSIS L L +FFL+ P ++ +G Sbjct: 274 LSISILLSLTVFFLLLAEIIPPTSLVVPLLG 304 >DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholine receptor alpha1subunit protein. Length = 601 Score = 22.2 bits (45), Expect = 5.8 Identities = 11/31 (35%), Positives = 15/31 (48%) Frame = -1 Query: 326 LSISTLSGLVLFFLMTLLAFPQPPIITSYIG 234 LSIS L L +FFL+ P + +G Sbjct: 270 LSISILLSLTVFFLLLAEIIPPTSLTVPLLG 300 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 21.8 bits (44), Expect = 7.7 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = -3 Query: 405 LASSGDNAAIPTNPKTTIFPSVK 337 +ASS N T TTI P VK Sbjct: 949 VASSASNVTNVTTNLTTILPPVK 971 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 220,223 Number of Sequences: 438 Number of extensions: 5189 Number of successful extensions: 23 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 21 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 25489170 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -