BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_F_E03 (783 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ237705-1|CAB40346.1| 557|Anopheles gambiae putative apyrase p... 27 0.87 AJ237704-1|CAB40345.1| 557|Anopheles gambiae apyrase protein. 27 0.87 EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calc... 23 8.1 >AJ237705-1|CAB40346.1| 557|Anopheles gambiae putative apyrase protein. Length = 557 Score = 26.6 bits (56), Expect = 0.87 Identities = 13/45 (28%), Positives = 21/45 (46%) Frame = -1 Query: 777 THEFLLDVLSDLSIVEEVAVFSDFPVDEENPLGKLLLRVQGFGQG 643 +H FL S ++ + D+PV N G+ +L VQ + G Sbjct: 254 SHSFLFPNASSKPHNQQDTILGDYPVVVSNANGRKILIVQAYAYG 298 >AJ237704-1|CAB40345.1| 557|Anopheles gambiae apyrase protein. Length = 557 Score = 26.6 bits (56), Expect = 0.87 Identities = 13/45 (28%), Positives = 21/45 (46%) Frame = -1 Query: 777 THEFLLDVLSDLSIVEEVAVFSDFPVDEENPLGKLLLRVQGFGQG 643 +H FL S ++ + D+PV N G+ +L VQ + G Sbjct: 254 SHSFLFPNASSKPHNQQDTILGDYPVVVSNANGRKILIVQAYAYG 298 >EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calcium channel alpha1 subunit protein. Length = 1893 Score = 23.4 bits (48), Expect = 8.1 Identities = 8/23 (34%), Positives = 14/23 (60%) Frame = +1 Query: 451 NNYQTNREGFAKLFRKLSDDSWE 519 NN+QT + LFR + ++W+ Sbjct: 1346 NNFQTFPQAVLVLFRSATGEAWQ 1368 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 753,234 Number of Sequences: 2352 Number of extensions: 14997 Number of successful extensions: 28 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 27 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 28 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 81913191 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -