BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_F_E02 (815 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_03_0459 + 16159015-16159771,16160251-16160365,16160478-161608... 29 5.8 >04_03_0459 + 16159015-16159771,16160251-16160365,16160478-16160844, 16160930-16161244,16161324-16161644,16161730-16161882 Length = 675 Score = 28.7 bits (61), Expect = 5.8 Identities = 17/56 (30%), Positives = 30/56 (53%) Frame = +3 Query: 204 QLLMWSVPSIAVLLGIFWFKKKREYAKSDPGGRERLKSLKEELAEVLNAQAEANRG 371 Q ++ S+P+ ++L G F KK E K R ++ +++ E+L Q +A RG Sbjct: 41 QAILPSMPNNSILFGTFMQKKLEELRKKAMKHRALVQGTQQQRFEIL-CQDKAGRG 95 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,092,326 Number of Sequences: 37544 Number of extensions: 314725 Number of successful extensions: 617 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 611 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 617 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2232933960 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -