BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_F_E01 (483 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. 25 1.4 DQ139954-1|ABA29475.1| 451|Anopheles gambiae protein O-fucosylt... 23 5.5 AY994095-1|AAX86008.1| 144|Anopheles gambiae unknown protein. 22 9.6 AF117750-1|AAD38336.1| 380|Anopheles gambiae serine protease 18... 22 9.6 >AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. Length = 3398 Score = 25.0 bits (52), Expect = 1.4 Identities = 15/38 (39%), Positives = 19/38 (50%) Frame = +2 Query: 95 HEVPLHVLSEGRSVPI*ILPPESVALALLGCRHRNFLT 208 H + + SE I +LPP+ ALA R R FLT Sbjct: 1872 HRLTTYTYSETYGHLIEVLPPQFHALAKTTSRTRPFLT 1909 >DQ139954-1|ABA29475.1| 451|Anopheles gambiae protein O-fucosyltransferase 2 protein. Length = 451 Score = 23.0 bits (47), Expect = 5.5 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = -1 Query: 261 TCLHFQGS 238 TCLHFQGS Sbjct: 203 TCLHFQGS 210 >AY994095-1|AAX86008.1| 144|Anopheles gambiae unknown protein. Length = 144 Score = 22.2 bits (45), Expect = 9.6 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = +2 Query: 65 PHDVGRPWSPHEVPLHVLSEGRSV 136 P V P+ PH VP V S+G + Sbjct: 7 PTSVHGPYPPHMVPGGVDSDGAQI 30 >AF117750-1|AAD38336.1| 380|Anopheles gambiae serine protease 18D protein. Length = 380 Score = 22.2 bits (45), Expect = 9.6 Identities = 7/16 (43%), Positives = 10/16 (62%) Frame = -1 Query: 192 WRQPSNARATDSGGKI 145 WRQP+ + D GG + Sbjct: 152 WRQPNGGYSFDCGGSL 167 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 413,038 Number of Sequences: 2352 Number of extensions: 7729 Number of successful extensions: 12 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 42285900 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -