BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_F_E01 (483 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 28 0.046 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 22 4.0 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 22 4.0 AF514804-1|AAM51823.1| 537|Apis mellifera neuronal nicotinic ac... 21 5.2 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 28.3 bits (60), Expect = 0.046 Identities = 15/45 (33%), Positives = 24/45 (53%) Frame = -1 Query: 231 FCEFCRRVVRKLRWRQPSNARATDSGGKIYMGTERPSLRTCKGTS 97 FC+ +R + K++WR+P A + Y+ E +LRT G S Sbjct: 24 FCQPTQRTMSKIQWRKPKPAMVEEKTQLRYL-EELNALRTELGAS 67 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 21.8 bits (44), Expect = 4.0 Identities = 10/30 (33%), Positives = 13/30 (43%) Frame = +3 Query: 48 SSFTYALTMSDAPGRPMKFPYTFSAKVAQF 137 ++ TY T D PG P S+ A F Sbjct: 1202 TTVTYCQTEEDVPGSPADIKVVVSSPQALF 1231 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 21.8 bits (44), Expect = 4.0 Identities = 10/30 (33%), Positives = 13/30 (43%) Frame = +3 Query: 48 SSFTYALTMSDAPGRPMKFPYTFSAKVAQF 137 ++ TY T D PG P S+ A F Sbjct: 1198 TTVTYCQTEEDVPGSPADIKVVVSSPQALF 1227 >AF514804-1|AAM51823.1| 537|Apis mellifera neuronal nicotinic acetylcholine receptoralpha-3 protein. Length = 537 Score = 21.4 bits (43), Expect = 5.2 Identities = 8/13 (61%), Positives = 11/13 (84%) Frame = +2 Query: 146 ILPPESVALALLG 184 I+PP S+A+ LLG Sbjct: 301 IIPPTSLAIPLLG 313 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 110,668 Number of Sequences: 438 Number of extensions: 2263 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 13174803 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -