BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_F_D06 (413 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U88165-5|AAK21392.1| 393|Caenorhabditis elegans Downstream of m... 29 1.8 U34893-1|AAB01720.1| 393|Caenorhabditis elegans DOM-3 protein. 29 1.8 AL033512-1|CAA22076.1| 606|Caenorhabditis elegans Hypothetical ... 27 5.4 AF148954-1|AAD37411.1| 4280|Caenorhabditis elegans myotactin for... 27 7.1 AF148953-1|AAD37410.1| 4450|Caenorhabditis elegans myotactin for... 27 7.1 AF040648-5|AAK21413.1| 4450|Caenorhabditis elegans Lethal protei... 27 7.1 AF040648-4|AAK21414.2| 4280|Caenorhabditis elegans Lethal protei... 27 7.1 >U88165-5|AAK21392.1| 393|Caenorhabditis elegans Downstream of mes (in same operon)protein 3 protein. Length = 393 Score = 28.7 bits (61), Expect = 1.8 Identities = 16/60 (26%), Positives = 28/60 (46%), Gaps = 3/60 (5%) Frame = -2 Query: 196 HVPAHGARPITKH*IITYIN---SERNPHVHGYQYETTDTYLLTHNMSLRIGKIRAKHTH 26 H+P +P+ I + N RNP Q + Y + ++ L++G++RAK H Sbjct: 28 HIPKITGQPLPNEVQIPFDNMIYETRNPPKFEKQAKFISEYCINYDRKLQLGRMRAKKFH 87 >U34893-1|AAB01720.1| 393|Caenorhabditis elegans DOM-3 protein. Length = 393 Score = 28.7 bits (61), Expect = 1.8 Identities = 16/60 (26%), Positives = 28/60 (46%), Gaps = 3/60 (5%) Frame = -2 Query: 196 HVPAHGARPITKH*IITYIN---SERNPHVHGYQYETTDTYLLTHNMSLRIGKIRAKHTH 26 H+P +P+ I + N RNP Q + Y + ++ L++G++RAK H Sbjct: 28 HIPKITGQPLPNEVQIPFDNMIYETRNPPKFEKQAKFISEYCINYDRKLQLGRMRAKKFH 87 >AL033512-1|CAA22076.1| 606|Caenorhabditis elegans Hypothetical protein Y49A3A.2 protein. Length = 606 Score = 27.1 bits (57), Expect = 5.4 Identities = 16/37 (43%), Positives = 22/37 (59%), Gaps = 1/37 (2%) Frame = -1 Query: 251 YKTLGLLYRML-LYSKALHSRPSTRCQTDNKTLNNYI 144 YKT+G+L M+ Y A H+ +T Q+DNK N I Sbjct: 524 YKTVGMLKNMIGFYDLARHAVEAT-AQSDNKITWNVI 559 >AF148954-1|AAD37411.1| 4280|Caenorhabditis elegans myotactin form A protein. Length = 4280 Score = 26.6 bits (56), Expect = 7.1 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = -3 Query: 111 DISTKQRTHIYLHTTCPYESVKFEPNT 31 D++ K+RTHI H T Y + P T Sbjct: 2266 DVNDKKRTHIVNHPTLTYLFEELNPET 2292 >AF148953-1|AAD37410.1| 4450|Caenorhabditis elegans myotactin form B protein. Length = 4450 Score = 26.6 bits (56), Expect = 7.1 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = -3 Query: 111 DISTKQRTHIYLHTTCPYESVKFEPNT 31 D++ K+RTHI H T Y + P T Sbjct: 2266 DVNDKKRTHIVNHPTLTYLFEELNPET 2292 >AF040648-5|AAK21413.1| 4450|Caenorhabditis elegans Lethal protein 805, isoform b protein. Length = 4450 Score = 26.6 bits (56), Expect = 7.1 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = -3 Query: 111 DISTKQRTHIYLHTTCPYESVKFEPNT 31 D++ K+RTHI H T Y + P T Sbjct: 2266 DVNDKKRTHIVNHPTLTYLFEELNPET 2292 >AF040648-4|AAK21414.2| 4280|Caenorhabditis elegans Lethal protein 805, isoform a protein. Length = 4280 Score = 26.6 bits (56), Expect = 7.1 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = -3 Query: 111 DISTKQRTHIYLHTTCPYESVKFEPNT 31 D++ K+RTHI H T Y + P T Sbjct: 2266 DVNDKKRTHIVNHPTLTYLFEELNPET 2292 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,442,809 Number of Sequences: 27780 Number of extensions: 151908 Number of successful extensions: 344 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 336 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 344 length of database: 12,740,198 effective HSP length: 74 effective length of database: 10,684,478 effective search space used: 673122114 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -