BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_F_D03 (463 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 22 3.2 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 22 3.2 DQ138189-1|ABA03053.1| 162|Tribolium castaneum bursicon protein. 20 9.7 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 21.8 bits (44), Expect = 3.2 Identities = 21/58 (36%), Positives = 24/58 (41%), Gaps = 2/58 (3%) Frame = -2 Query: 228 LPKPIHLHHQRLLYP--NFPQEILRTRHPLLANQGLLSVCQPLYCDDY*NKEISLIIA 61 LP P H HHQ P P +I +PL NQ L C D KE II+ Sbjct: 735 LPPPPHPHHQPPRNPVGTNPHDI---NNPLSVNQ-LTGQCVRNDSSDTNGKETRSIIS 788 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 21.8 bits (44), Expect = 3.2 Identities = 21/58 (36%), Positives = 24/58 (41%), Gaps = 2/58 (3%) Frame = -2 Query: 228 LPKPIHLHHQRLLYP--NFPQEILRTRHPLLANQGLLSVCQPLYCDDY*NKEISLIIA 61 LP P H HHQ P P +I +PL NQ L C D KE II+ Sbjct: 627 LPPPPHPHHQPPRNPVGTNPHDI---NNPLSVNQ-LTGQCVRNDSSDTNGKETRSIIS 680 >DQ138189-1|ABA03053.1| 162|Tribolium castaneum bursicon protein. Length = 162 Score = 20.2 bits (40), Expect = 9.7 Identities = 6/8 (75%), Positives = 7/8 (87%) Frame = -2 Query: 237 PSCLPKPI 214 P C+PKPI Sbjct: 53 PGCVPKPI 60 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 74,830 Number of Sequences: 336 Number of extensions: 1478 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 10616413 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -