BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_F_D02 (779 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g09760.1 68414.m01095 U2 small nuclear ribonucleoprotein A, p... 225 2e-59 At3g50690.1 68416.m05546 leucine-rich repeat family protein 47 1e-05 At4g03260.1 68417.m00445 leucine-rich repeat family protein cont... 44 1e-04 At2g34680.1 68415.m04260 leucine-rich repeat family protein cont... 42 3e-04 At1g71440.1 68414.m08253 tubulin folding cofactor E / Pfifferlin... 41 8e-04 At1g48540.2 68414.m05428 leucine-rich repeat family protein 41 8e-04 At1g48540.1 68414.m05427 leucine-rich repeat family protein 41 8e-04 At1g04210.1 68414.m00411 leucine-rich repeat family protein / pr... 40 0.002 At4g34280.1 68417.m04873 transducin family protein / WD-40 repea... 39 0.004 At3g17920.1 68416.m02282 leucine-rich repeat family protein cont... 39 0.004 At1g47890.1 68414.m05333 disease resistance family protein conta... 38 0.006 At1g78230.1 68414.m09116 leucine-rich repeat family protein 38 0.007 At5g22320.1 68418.m02604 leucine-rich repeat family protein cont... 37 0.017 At1g72180.1 68414.m08346 leucine-rich repeat transmembrane prote... 34 0.092 At2g33080.1 68415.m04056 leucine-rich repeat family protein cont... 33 0.16 At2g26330.1 68415.m03159 leucine-rich repeat protein kinase, put... 33 0.28 At3g23010.1 68416.m02901 disease resistance family protein / LRR... 31 1.1 At4g24490.1 68417.m03510 geranylgeranyl transferase alpha subuni... 30 1.5 At5g20690.1 68418.m02457 leucine-rich repeat transmembrane prote... 30 2.0 At4g37810.1 68417.m05350 expressed protein 30 2.0 At5g04890.1 68418.m00513 small heat shock-like protein (RTM2) si... 29 3.5 At4g27890.1 68417.m04003 nuclear movement family protein contain... 29 3.5 At3g05660.1 68416.m00630 disease resistance family protein conta... 29 3.5 At5g05400.1 68418.m00582 disease resistance protein (CC-NBS-LRR ... 29 4.6 At4g14605.1 68417.m02247 mitochondrial transcription termination... 29 4.6 At4g04220.1 68417.m00598 disease resistance family protein conta... 29 4.6 At2g32680.1 68415.m03995 disease resistance family protein conta... 29 4.6 At1g72460.1 68414.m08379 leucine-rich repeat transmembrane prote... 29 4.6 At4g36080.1 68417.m05136 FAT domain-containing protein / phospha... 28 6.0 At3g42880.1 68416.m04495 leucine-rich repeat transmembrane prote... 28 6.0 At3g06060.1 68416.m00693 short-chain dehydrogenase/reductase (SD... 28 6.0 At2g46490.1 68415.m05786 expressed protein (APS2) identical to c... 28 6.0 At1g08290.1 68414.m00915 zinc finger (C2H2 type) protein (WIP3) ... 28 6.0 At1g02290.1 68414.m00171 expressed protein 28 6.0 At5g01690.1 68418.m00086 cation/hydrogen exchanger, putative (CH... 28 8.0 At4g24760.1 68417.m03545 expressed protein 28 8.0 At3g20190.1 68416.m02559 leucine-rich repeat transmembrane prote... 28 8.0 At1g74180.1 68414.m08591 leucine-rich repeat family protein cont... 28 8.0 At1g70940.1 68414.m08184 auxin transport protein, putative (PIN3... 28 8.0 At1g56660.1 68414.m06516 expressed protein 28 8.0 At1g51220.1 68414.m05761 zinc finger (C2H2 type) protein (WIP5) ... 28 8.0 At1g34790.1 68414.m04337 transparent testa 1 protein (TT1) / zin... 28 8.0 >At1g09760.1 68414.m01095 U2 small nuclear ribonucleoprotein A, putative identical to U2 small nuclear ribonucleoprotein A' (U2 snRNP-A') [Arabidopsis thaliana] SWISS-PROT:P43333; supported by cDNA:gi_16649064_gb_AY059902.1_ Length = 249 Score = 225 bits (551), Expect = 2e-59 Identities = 117/249 (46%), Positives = 164/249 (65%), Gaps = 3/249 (1%) Frame = +3 Query: 42 MVKLTTELIQNSMQYMNPCRDRELDLRGYKIPQIENLGATLDQFDTIDFSDNDIRKLDGF 221 MVKLT +LI S + N ++RELDLRG KIP IENLGAT DQFDTID SDN+I KL+ F Sbjct: 1 MVKLTADLIWKSPHFFNAIKERELDLRGNKIPVIENLGATEDQFDTIDLSDNEIVKLENF 60 Query: 222 PLLKRLKCILLNNNRIVRIGENLEHYIPNLESVILTNNNISELGDLDPLSTLPKLRTLSL 401 P L RL +L+NNNRI RI NL ++P L S++LTNN + L ++DPL+++PKL+ LSL Sbjct: 61 PYLNRLGTLLINNNRITRINPNLGEFLPKLHSLVLTNNRLVNLVEIDPLASIPKLQYLSL 120 Query: 402 MHNPVANKNHYRAYVAFKMPELRLLDFRKIKQKERDEANALFKSRKGKEIQREIAKK--A 575 + N + K +YR YV K+ LR+LDF KIK KER EA +LF S++ +E ++++++ Sbjct: 121 LDNNITKKANYRLYVIHKLKSLRVLDFIKIKAKERAEAASLFSSKEAEEEVKKVSREEVK 180 Query: 576 KTFVPGGNMPDPKVTNLTPQEIHKIREAIKNASSLQEVERLTRMLQSGQIP-GQKPLQPV 752 K N PKV T ++I I+ AI N+ +++E+ RL + L+ GQ+P G P Sbjct: 181 KVSETAENPETPKVVAPTAEQILAIKAAIINSQTIEEIARLEQALKFGQVPAGLIIPDPA 240 Query: 753 TQTNGQXDE 779 T + +E Sbjct: 241 TNDSAPMEE 249 >At3g50690.1 68416.m05546 leucine-rich repeat family protein Length = 447 Score = 47.2 bits (107), Expect = 1e-05 Identities = 35/107 (32%), Positives = 57/107 (53%), Gaps = 1/107 (0%) Frame = +3 Query: 201 IRKLDGFPLLKRLKCILLNNNRI-VRIGENLEHYIPNLESVILTNNNISELGDLDPLSTL 377 + L+ FP L L+ ++L++NRI V + +E + + + L+NN I + DL PL+ L Sbjct: 60 VSSLEQFPRLGNLQKLILSDNRITVGLEFLVEAGLDSFCDLDLSNNRIQFVEDLAPLAEL 119 Query: 378 PKLRTLSLMHNPVANKNHYRAYVAFKMPELRLLDFRKIKQKERDEAN 518 KL +L L PV YR+ V + L+ LD + ER E++ Sbjct: 120 -KLVSLDLYECPVTRLKDYRSRVFGLIKTLKYLDKTDAEGNERPESD 165 >At4g03260.1 68417.m00445 leucine-rich repeat family protein contains leucine rich repeat (LRR) domains, Pfam:PF00560 Length = 677 Score = 44.0 bits (99), Expect = 1e-04 Identities = 35/102 (34%), Positives = 51/102 (50%) Frame = +3 Query: 105 RELDLRGYKIPQIENLGATLDQFDTIDFSDNDIRKLDGFPLLKRLKCILLNNNRIVRIGE 284 R L+L G I +I GA ++ S N I ++G L RL+ + L+ NRI+R+G Sbjct: 422 RVLNLSGNAIVRI-TAGALPRGLHALNLSKNSISVIEGLRELTRLRVLDLSYNRILRLGH 480 Query: 285 NLEHYIPNLESVILTNNNISELGDLDPLSTLPKLRTLSLMHN 410 L +L+ + L N ISE ++ L L KL L L N Sbjct: 481 GLAS-CSSLKELYLAGNKISE---IEGLHRLLKLTVLDLRFN 518 >At2g34680.1 68415.m04260 leucine-rich repeat family protein contains leucine rich repeat (LRR) domains, Pfam:PF00560; identical to cDNA hypothetical protein (AIR9) mRNA, partial cds GI:3695020 Length = 1661 Score = 42.3 bits (95), Expect = 3e-04 Identities = 46/152 (30%), Positives = 68/152 (44%), Gaps = 9/152 (5%) Frame = +3 Query: 102 DRELDLRGYKIPQIENLGATLD-QFDTIDFSDNDIRKLDGFPLLKRLKCILLNNNRIVRI 278 D LDLRG++I + + G L + + DN + L+G +L R+K + L+ N Sbjct: 270 DMRLDLRGHRIRSLTSGGLHLSPNLEFVYLRDNLLSTLEGIEILNRVKVLDLSFNDFKGP 329 Query: 279 G-ENLEHYIPNLESVILTNNNISELGDLDPLSTLPKLRTLSLMHN-----PVANKNHYRA 440 G E LE+ L+ + L N I+ L L LP L LS+ N +A++ + Sbjct: 330 GFEPLEN-CKMLQQLYLAGNQITSLAS---LPQLPNLEFLSVAQNKLKSLAMASQPRLQV 385 Query: 441 YVAFKMPELRLLDFRKIKQKE--RDEANALFK 530 A K L DF + E R E N L K Sbjct: 386 LAASKNKITTLKDFPYLPVLEHLRVEENPLLK 417 >At1g71440.1 68414.m08253 tubulin folding cofactor E / Pfifferling (PFI) almost identical to tubulin folding cofactor E (Pfifferling; PFI) GI:20514267 from [Arabidopsis thaliana]; identical to cDNA tubulin folding cofactor E, GI:20514266 Length = 531 Score = 41.1 bits (92), Expect = 8e-04 Identities = 37/155 (23%), Positives = 77/155 (49%), Gaps = 19/155 (12%) Frame = +3 Query: 108 ELDLRGYKIPQIENLGATLDQ-FDTI---DFSDNDIRKLDGFPLLKRLKCI---LLNNNR 266 EL L G I I + ++ DQ F+++ + DN I L +L C+ LN N+ Sbjct: 238 ELHLMGNMISTITSTSSSDDQAFNSLRLLNLDDNCISDWSEVLKLSQLPCLEQLYLNKNK 297 Query: 267 IVRIGENLEHY---------IPNLESVILTNNNISELGDLDPLSTLPKLRTLSLMHNPVA 419 + RI +++ P+L ++L NNI +L +D L+ P+L + L NP++ Sbjct: 298 LSRIFQSVNGTESSEKGSDPFPSLSCLLLGANNIGDLASVDALNGFPQLVDIRLSENPIS 357 Query: 420 NK---NHYRAYVAFKMPELRLLDFRKIKQKERDEA 515 + R + ++ ++++L+ +++ +E+ ++ Sbjct: 358 DPVRGGVPRFVLVARLTKVQVLNGSEVRAREKKDS 392 >At1g48540.2 68414.m05428 leucine-rich repeat family protein Length = 1051 Score = 41.1 bits (92), Expect = 8e-04 Identities = 40/150 (26%), Positives = 75/150 (50%), Gaps = 3/150 (2%) Frame = +3 Query: 63 LIQNSMQYMNPCRDRELDLRGYKIPQIENLGATLDQFDTIDFSDNDIRKLDGFPLLK-RL 239 L+ S+Q + P + LDL K +++NL + +D N +R + + L Sbjct: 182 LMDESLQLL-PAAE-SLDLSRNKFVKVDNL-RRCTKLKHLDLGFNHLRTVSYLSQVSCHL 238 Query: 240 KCILLNNNRIVRIGENLEHYIPNLESVILTNNNISELGDLDPLSTLPKLRTLSLMHNPVA 419 ++L NN + + +E+ + +L+ + ++ N IS +L+ L +L +L+ L L NPV Sbjct: 239 VKLVLRNNALTTL-RGIEN-LKSLQGLDVSYNIISNFSELEFLWSLSQLKELWLEGNPVC 296 Query: 420 NKNHYRAYV--AFKMPELRLLDFRKIKQKE 503 YRA+V +P+ LD ++I +E Sbjct: 297 CARWYRAHVFSYVALPDELKLDGKQIGTRE 326 >At1g48540.1 68414.m05427 leucine-rich repeat family protein Length = 1063 Score = 41.1 bits (92), Expect = 8e-04 Identities = 40/150 (26%), Positives = 75/150 (50%), Gaps = 3/150 (2%) Frame = +3 Query: 63 LIQNSMQYMNPCRDRELDLRGYKIPQIENLGATLDQFDTIDFSDNDIRKLDGFPLLK-RL 239 L+ S+Q + P + LDL K +++NL + +D N +R + + L Sbjct: 182 LMDESLQLL-PAAE-SLDLSRNKFVKVDNL-RRCTKLKHLDLGFNHLRTVSYLSQVSCHL 238 Query: 240 KCILLNNNRIVRIGENLEHYIPNLESVILTNNNISELGDLDPLSTLPKLRTLSLMHNPVA 419 ++L NN + + +E+ + +L+ + ++ N IS +L+ L +L +L+ L L NPV Sbjct: 239 VKLVLRNNALTTL-RGIEN-LKSLQGLDVSYNIISNFSELEFLWSLSQLKELWLEGNPVC 296 Query: 420 NKNHYRAYV--AFKMPELRLLDFRKIKQKE 503 YRA+V +P+ LD ++I +E Sbjct: 297 CARWYRAHVFSYVALPDELKLDGKQIGTRE 326 >At1g04210.1 68414.m00411 leucine-rich repeat family protein / protein kinase family protein contains Pfam domains PF00560: Leucine Rich Repeat and PF00069: Protein kinase domain Length = 1112 Score = 39.5 bits (88), Expect = 0.002 Identities = 26/84 (30%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = +3 Query: 162 LDQFDTIDFSDNDIRKLDG-FPLLKRLKCILLNNNRIVRIGENLEHYIPNLESVILTNNN 338 L + +D S N I+ L L L + + +NR++ + L + NLES+ ++NN Sbjct: 175 LKSLEYLDLSFNKIKSLPNEIGYLSSLTFLKVAHNRLMELSPVLA-LLQNLESLDVSNNR 233 Query: 339 ISELGDLDPLSTLPKLRTLSLMHN 410 ++ L LD L+ +P+L+ L+L +N Sbjct: 234 LTTLHPLD-LNLMPRLQILNLRYN 256 >At4g34280.1 68417.m04873 transducin family protein / WD-40 repeat family protein similar to TUPA (GI:11066216) [Emericella nidulans]; similar to damage-specific DNA binding protein 2, Homo sapiens ,PIR2:I38909; contains Pfam PF00400: WD domain, G-beta repeat (3 copies,1 weak)|19797453|gb|AU229277.1|AU229277 Length = 783 Score = 38.7 bits (86), Expect = 0.004 Identities = 15/44 (34%), Positives = 30/44 (68%) Frame = +3 Query: 384 LRTLSLMHNPVANKNHYRAYVAFKMPELRLLDFRKIKQKERDEA 515 L+ +S +P+ ++ HYR Y+ +P+L++LD I++ +RD+A Sbjct: 324 LKYISSKASPICSEKHYRMYMINSLPKLQVLDNLAIRKSDRDKA 367 Score = 28.7 bits (61), Expect = 4.6 Identities = 20/66 (30%), Positives = 33/66 (50%), Gaps = 1/66 (1%) Frame = +3 Query: 201 IRKLDGFPLLKRLKCILLNNNRIVRIGENLEHYIPNLESVILTNNNISEL-GDLDPLSTL 377 I KL+ +L ++L+ NRIV GE+ +P L + + + +S+L L L Sbjct: 138 IHKLNIVGEFTQLHTLILDKNRIVGFGEDCFSCMPKLTYLSMCDTLVSDLWTSAAALLKL 197 Query: 378 PKLRTL 395 P L+ L Sbjct: 198 PSLKEL 203 >At3g17920.1 68416.m02282 leucine-rich repeat family protein contains leucine rich repeat (LRR) domains, Pfam:PF00560 Length = 962 Score = 38.7 bits (86), Expect = 0.004 Identities = 43/163 (26%), Positives = 76/163 (46%), Gaps = 2/163 (1%) Frame = +3 Query: 63 LIQNSMQYMNPCRDRELDLRGYKIPQIENLGATLDQFDTIDFSDNDIRKLDGFPLLKRLK 242 L+ S+Q + P + LDL K +++NL ++ +D N +RK+ + + + Sbjct: 182 LMDESLQLL-PAVE-SLDLSRNKFAKVDNL-RRCNKLKHLDLGFNQLRKISHLSEVGKFR 238 Query: 243 CILLNNNRIVRIGENLEHYIPNLESVILTNNNISELGDLDPLSTLPKLRTLSLMHNPVAN 422 L R + ENL+ +LE + ++ N IS+ +L+ L +L L L L NP+ Sbjct: 239 NNALTTLRGI---ENLK----SLEGLDVSFNLISDFSELEFLGSLSFLTDLWLEGNPICC 291 Query: 423 KNHYRAYVA--FKMPELRLLDFRKIKQKERDEANALFKSRKGK 545 YRA+V +P LD + I +E + + RK + Sbjct: 292 ARWYRAHVLSYVYLPNDLKLDGKHIGNREFWKRQVVVTRRKSQ 334 >At1g47890.1 68414.m05333 disease resistance family protein contains leucine rich-repeat domains Pfam:PF00560, INTERPRO:IPR001611; similar to Cf-2.2 [Lycopersicon pimpinellifolium] gi|1184077|gb|AAC15780 Length = 1019 Score = 38.3 bits (85), Expect = 0.006 Identities = 29/84 (34%), Positives = 48/84 (57%), Gaps = 4/84 (4%) Frame = +3 Query: 171 FDTIDFSDNDIR-KL-DGFPLLKRLKCILLNNNRIV-RIGENLEHYIPNLESVILTNNNI 341 + ID S N + K+ D LLK L+ + +++N I +L + + NLES+ ++ NNI Sbjct: 833 YTAIDLSGNQLHGKIPDSIGLLKELRILNMSSNGFTGHIPSSLAN-LKNLESLDISQNNI 891 Query: 342 SELGDLDP-LSTLPKLRTLSLMHN 410 S G++ P L TL L +++ HN Sbjct: 892 S--GEIPPELGTLSSLAWINVSHN 913 >At1g78230.1 68414.m09116 leucine-rich repeat family protein Length = 676 Score = 37.9 bits (84), Expect = 0.007 Identities = 27/80 (33%), Positives = 43/80 (53%) Frame = +3 Query: 180 IDFSDNDIRKLDGFPLLKRLKCILLNNNRIVRIGENLEHYIPNLESVILTNNNISELGDL 359 ++ S N I ++G L RL+ + L+ NRI RIG+ L + ++ + L N IS ++ Sbjct: 473 LNLSKNKISVIEGLRDLTRLRVLDLSYNRISRIGQGLSN-CTLIKELYLAGNKIS---NV 528 Query: 360 DPLSTLPKLRTLSLMHNPVA 419 + L L KL L L N +A Sbjct: 529 EGLHRLLKLIVLDLSFNKIA 548 >At5g22320.1 68418.m02604 leucine-rich repeat family protein contains leucine rich repeat (LRR) domains, Pfam:PF00560 Length = 452 Score = 36.7 bits (81), Expect = 0.017 Identities = 23/76 (30%), Positives = 40/76 (52%) Frame = +3 Query: 189 SDNDIRKLDGFPLLKRLKCILLNNNRIVRIGENLEHYIPNLESVILTNNNISELGDLDPL 368 +DN+I + LLK L ++L+ N I IG++L + NL + L++ I +G L Sbjct: 115 NDNEISSICKLDLLKDLNSLVLSRNPISEIGDSLSK-LKNLSKISLSDCRIKAIG--SSL 171 Query: 369 STLPKLRTLSLMHNPV 416 + L+ L L +N + Sbjct: 172 KSCSDLKELRLANNEI 187 >At1g72180.1 68414.m08346 leucine-rich repeat transmembrane protein kinase, putative similar to GI:3641252 from [Malus x domestica] (Plant Mol. Biol. 40 (6), 945-957 (1999)) Length = 977 Score = 34.3 bits (75), Expect = 0.092 Identities = 27/74 (36%), Positives = 39/74 (52%), Gaps = 8/74 (10%) Frame = +3 Query: 180 IDFSDNDI--RKLDGFPLLKRLKCILLNNNRIV-RIGENLEHYIPNLESVILTNNNIS-- 344 ID SDN++ L L ++L NNR +I L + N+E + L+NNN+S Sbjct: 415 IDLSDNELTGEVSPQIGLSTELSQLILQNNRFSGKIPRELGR-LTNIERIYLSNNNLSGE 473 Query: 345 ---ELGDLDPLSTL 377 E+GDL LS+L Sbjct: 474 IPMEVGDLKELSSL 487 >At2g33080.1 68415.m04056 leucine-rich repeat family protein contains leucine rich-repeat domain Pfam:PF00560, INTERPRO:IPR001611; contains similarity to Cf-2.2 [Lycopersicon pimpinellifolium] gi|1184077|gb|AAC15780 Length = 740 Score = 33.5 bits (73), Expect = 0.16 Identities = 30/94 (31%), Positives = 47/94 (50%), Gaps = 4/94 (4%) Frame = +3 Query: 162 LDQFDTIDFSDNDIRKL--DGFPLLKRLKCILLNNNRIV-RIGENLEHYIPNLESVILTN 332 L+ + IDFS N + LLK L + L+NN I +L + LES+ L+ Sbjct: 601 LNSYSAIDFSGNRLEGQIPKSIGLLKELIALNLSNNAFTCHIPLSLAN-ATELESLDLSR 659 Query: 333 NNISELGDL-DPLSTLPKLRTLSLMHNPVANKNH 431 N +S G + + L TL L +++ HN + +NH Sbjct: 660 NQLS--GTIPNGLKTLSFLAYINVSHNKLKGENH 691 >At2g26330.1 68415.m03159 leucine-rich repeat protein kinase, putative (ERECTA) identical to uncharacterized receptor protein kinase ERECTA [Arabidopsis thaliana] gi|1389566|dbj|BAA11869; contains Pfam domains PF00560: Leucine Rich Repeat and PF00069: Protein kinase domain Length = 976 Score = 32.7 bits (71), Expect = 0.28 Identities = 23/81 (28%), Positives = 42/81 (51%), Gaps = 3/81 (3%) Frame = +3 Query: 111 LDLRGYKIP-QIENLGATLDQFDTIDFSDNDIRKLDGFPL--LKRLKCILLNNNRIVRIG 281 +DLRG ++ QI + +D S N++ F + LK+L+ ++L NN+++ Sbjct: 97 IDLRGNRLSGQIPDEIGDCSSLQNLDLSFNELSGDIPFSISKLKQLEQLILKNNQLIGPI 156 Query: 282 ENLEHYIPNLESVILTNNNIS 344 + IPNL+ + L N +S Sbjct: 157 PSTLSQIPNLKILDLAQNKLS 177 >At3g23010.1 68416.m02901 disease resistance family protein / LRR family protein contains leucine rich-repeat domains Pfam:PF00560, INTERPRO:IPR001611; contains similarity to Cf-2.2 [Lycopersicon pimpinellifolium] gi|1184077|gb|AAC15780 Length = 595 Score = 30.7 bits (66), Expect = 1.1 Identities = 32/95 (33%), Positives = 48/95 (50%), Gaps = 3/95 (3%) Frame = +3 Query: 171 FDTIDFSDNDIR-KLDG-FPLLKRLKCILLNNNRIV-RIGENLEHYIPNLESVILTNNNI 341 F+ IDFS N + G LL L+ + L+ N I +L + I NLES+ L+ NN+ Sbjct: 430 FNAIDFSGNRFSGHIPGSIGLLSELRLLNLSGNAFTGNIPPSLAN-ITNLESLDLSRNNL 488 Query: 342 SELGDLDPLSTLPKLRTLSLMHNPVANKNHYRAYV 446 S G++ P+S L LS + N + NH + Sbjct: 489 S--GEI-PIS----LGKLSFLSNTNFSYNHLEGLI 516 >At4g24490.1 68417.m03510 geranylgeranyl transferase alpha subunit-related / RAB geranylgeranyltransferase alpha subunit-related low similarity to SP|Q08602 [Rattus norvegicus] Length = 683 Score = 30.3 bits (65), Expect = 1.5 Identities = 15/58 (25%), Positives = 34/58 (58%), Gaps = 2/58 (3%) Frame = +3 Query: 180 IDFSDNDIRKLDGFPLLKRLKCILLNNNRIVRIG--ENLEHYIPNLESVILTNNNISE 347 +D S N++ +G ++ L C+ L++NRI ++L H + L+ + +++N+I + Sbjct: 543 LDLSHNELHSTEGLEAMQLLSCLNLSHNRIRSFSALDSLRH-VKQLKVLDVSHNHIGK 599 >At5g20690.1 68418.m02457 leucine-rich repeat transmembrane protein kinase, putative receptor-like protein kinase PRK1, tomato, PIR:T07865 Length = 659 Score = 29.9 bits (64), Expect = 2.0 Identities = 25/70 (35%), Positives = 38/70 (54%), Gaps = 3/70 (4%) Frame = +3 Query: 210 LDGFPLLKRLKCILLNNNRIVRIGENLEHY--IPNLESVILTNNNIS-ELGDLDPLSTLP 380 +D L LK I L+NN + L H+ + L+S++L+NN+ S E+ D D + Sbjct: 89 VDDLKDLPNLKTIRLDNNLL---SGPLPHFFKLRGLKSLMLSNNSFSGEIRD-DFFKDMS 144 Query: 381 KLRTLSLMHN 410 KL+ L L HN Sbjct: 145 KLKRLFLDHN 154 >At4g37810.1 68417.m05350 expressed protein Length = 128 Score = 29.9 bits (64), Expect = 2.0 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = -2 Query: 292 SKFSPILTILLLFNRIHFNLFSSGKP 215 S S L ILL+ N HF+L ++G+P Sbjct: 5 SNMSSFLLILLILNSTHFSLMANGRP 30 >At5g04890.1 68418.m00513 small heat shock-like protein (RTM2) similar to 17.9 kDa heat-shock protein [Helianthus annuus] GI:11990130; contains Pfam profile PF00011: Hsp20/alpha crystallin family; supporting cDNA gi|7407072|gb|AF208051.1|AF208051; identical to cDNA small heat shock-like protein (RTM2) GI:7407072, small heat shock-like protein [Arabidopsis thaliana] GI:7407073 Length = 366 Score = 29.1 bits (62), Expect = 3.5 Identities = 20/72 (27%), Positives = 38/72 (52%), Gaps = 3/72 (4%) Frame = +3 Query: 372 TLPKLRTLSLMHNPVANKNHYRAYV-AFKMPELRLLDFRKIKQKERDEANALFKS--RKG 542 T+PK + + P ++ A A K+ E RLL+ + K+KE +EA + K + Sbjct: 100 TMPKETITKVAYLPETSRTEAAALEKAAKLEEKRLLEESRRKEKEEEEAKQMKKQLLEEK 159 Query: 543 KEIQREIAKKAK 578 + + R++ ++AK Sbjct: 160 EALIRKLQEEAK 171 >At4g27890.1 68417.m04003 nuclear movement family protein contains Pfam profile: PF03593 nuclear movement protein Length = 293 Score = 29.1 bits (62), Expect = 3.5 Identities = 23/83 (27%), Positives = 35/83 (42%), Gaps = 2/83 (2%) Frame = +3 Query: 495 QKERDEANALFKSRKGKEIQREIAKKA--KTFVPGGNMPDPKVTNLTPQEIHKIREAIKN 668 +K+ E + K+ RE KK K V + PK +L P E+ K +E Sbjct: 45 KKDTAEKEIVAAVMAAKQRLREAEKKKLEKESVKSMEVEKPKKDSLKPTELEKPKEESLM 104 Query: 669 ASSLQEVERLTRMLQSGQIPGQK 737 A+ E+E+ +SG I K Sbjct: 105 ATDPMEIEKPKEEKESGPIVPNK 127 >At3g05660.1 68416.m00630 disease resistance family protein contains leucine rich-repeat (LRR) domains Pfam:PF00560, INTERPRO:IPR001611; similar to Cf-2.2 [Lycopersicon pimpinellifolium] gi|1184077|gb|AAC15780 Length = 883 Score = 29.1 bits (62), Expect = 3.5 Identities = 23/83 (27%), Positives = 41/83 (49%), Gaps = 5/83 (6%) Frame = +3 Query: 111 LDLRGYKIPQIENLGATLDQFDTIDFSDNDIRKLDGFPLLKRLKCILLNNNRIVRI--GE 284 L+L G I + ++ T Q T+D S+N I+ LL +L+ + ++NN + Sbjct: 410 LNLSGCGITEFPDILRTQRQMRTLDISNNKIKGQVPSWLLLQLEYMHISNNNFIGFERST 469 Query: 285 NLEHYI---PNLESVILTNNNIS 344 LE + P+++ +NNN S Sbjct: 470 KLEKTVVPKPSMKHFFGSNNNFS 492 >At5g05400.1 68418.m00582 disease resistance protein (CC-NBS-LRR class), putative domain signature CC-NBS-LRR exists, suggestive of a disease resistance protein. Length = 874 Score = 28.7 bits (61), Expect = 4.6 Identities = 16/49 (32%), Positives = 28/49 (57%), Gaps = 1/49 (2%) Frame = +3 Query: 234 RLKCILLNNNRIVRIGENLEHYIPNLESVILT-NNNISELGDLDPLSTL 377 +L+ +LL +NR+ +I ++P L + L+ N N+ EL PL +L Sbjct: 528 KLETLLLRDNRLRKISREFLSHVPILMVLDLSLNPNLIELPSFSPLYSL 576 >At4g14605.1 68417.m02247 mitochondrial transcription termination factor-related / mTERF-related contains Pfam profile PF02536: mTERF Length = 444 Score = 28.7 bits (61), Expect = 4.6 Identities = 20/70 (28%), Positives = 31/70 (44%), Gaps = 2/70 (2%) Frame = -3 Query: 324 KSQTLNLVYNVPNSLLSSRSCYYS-IEYIS-TFLAVENRQAF*YRCPRSLSYQIDRA*HP 151 K+Q ++ P L SR S +E++S T L E RCP +SY ++ P Sbjct: 282 KNQWAKIISRFPAILTYSRQKLTSTVEFLSQTGLTEEQIGRILTRCPNIMSYSVEDKLRP 341 Query: 150 DFRFVESYNL 121 + S N+ Sbjct: 342 TMEYFRSLNV 351 >At4g04220.1 68417.m00598 disease resistance family protein contains leucine rich-repeat (LRR) domains Pfam:PF00560, INTERPRO:IPR001611; similar to Hcr2-2A [Lycopersicon pimpinellifolium] gi|3894389|gb|AAC78594 Length = 811 Score = 28.7 bits (61), Expect = 4.6 Identities = 31/109 (28%), Positives = 50/109 (45%), Gaps = 5/109 (4%) Frame = +3 Query: 162 LDQFDTIDFSDNDIRKL--DGFPLLKRLKCILLNNNRIVRIGENLEHYIPNLESVILTNN 335 L + TID +N + D L L + L+ N++ + H + NLE++ L NN Sbjct: 225 LTKLKTIDLQNNFLSSKIPDDIGNLVNLSTLSLSMNKLSGGIPSSIHNLKNLETLQLENN 284 Query: 336 NISELGDLDP--LSTLPKLRTLSLM-HNPVANKNHYRAYVAFKMPELRL 473 N G++ L L KL+ L L +N + N+ + FK+ L L Sbjct: 285 N-GLSGEIPAAWLFGLQKLKVLRLEGNNKLQWNNNGYVFPQFKLTHLSL 332 >At2g32680.1 68415.m03995 disease resistance family protein contains leucine rich-repeat (LRR) domains Pfam:PF00560, INTERPRO:IPR001611; similar to Cf-2.2 [Lycopersicon pimpinellifolium] gi|1184077|gb|AAC15780 Length = 890 Score = 28.7 bits (61), Expect = 4.6 Identities = 18/41 (43%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = +3 Query: 306 NLESVILTNNNISELGDL-DPLSTLPKLRTLSLMHNPVANK 425 NLE V L NNN+ G + D L LRTL + HN + K Sbjct: 529 NLELVYLRNNNLE--GSIPDALCDGASLRTLDVSHNRLTGK 567 >At1g72460.1 68414.m08379 leucine-rich repeat transmembrane protein kinase, putative contains Pfam profiles: PF00560 leucine rich repeat (5 copies), PF00069 eukaryotic protein kinase domain Length = 644 Score = 28.7 bits (61), Expect = 4.6 Identities = 24/85 (28%), Positives = 38/85 (44%), Gaps = 2/85 (2%) Frame = +3 Query: 162 LDQFDTIDFSDNDIR-KLDGFPLLKRLKCILLNNNRIV-RIGENLEHYIPNLESVILTNN 335 L TI +N + F L LK + ++ NR I + + +L+ L+NN Sbjct: 89 LPSLRTISIMNNSFSGDIPEFNRLTALKSLYISGNRFSGNIPSDYFETMVSLKKAWLSNN 148 Query: 336 NISELGDLDPLSTLPKLRTLSLMHN 410 + S L + +TLP L L L +N Sbjct: 149 HFSGLIPISLATTLPNLIELRLENN 173 Score = 28.3 bits (60), Expect = 6.0 Identities = 11/19 (57%), Positives = 15/19 (78%) Frame = +3 Query: 354 DLDPLSTLPKLRTLSLMHN 410 D+ PL LP LRT+S+M+N Sbjct: 82 DVAPLKDLPSLRTISIMNN 100 >At4g36080.1 68417.m05136 FAT domain-containing protein / phosphatidylinositol 3- and 4-kinase family protein contains Pfam profiles PF00454: Phosphatidylinositol 3- and 4-kinase, PF02259: FAT domain, PF02260: FATC domain Length = 3839 Score = 28.3 bits (60), Expect = 6.0 Identities = 18/65 (27%), Positives = 37/65 (56%) Frame = +3 Query: 174 DTIDFSDNDIRKLDGFPLLKRLKCILLNNNRIVRIGENLEHYIPNLESVILTNNNISELG 353 + +D ++ND R+ +++ L L N+N + + +N+++ + L S T + +SEL Sbjct: 1183 NNVDEANNDARRQSFQDVVEYLATELFNSNASITVRKNVQNCLALLAS--RTGSEVSEL- 1239 Query: 354 DLDPL 368 L+PL Sbjct: 1240 -LEPL 1243 >At3g42880.1 68416.m04495 leucine-rich repeat transmembrane protein kinase, putative receptor-like protein kinase PRK1, Lycopersicon esculentum, PIR:T07865 Length = 633 Score = 28.3 bits (60), Expect = 6.0 Identities = 22/68 (32%), Positives = 39/68 (57%), Gaps = 2/68 (2%) Frame = +3 Query: 228 LKRLKCILLNNNRIVRIGENLEHY-IPNLESVILTNNNIS-ELGDLDPLSTLPKLRTLSL 401 L L+ I L+NN + G + +P L+S++L+NN+ S E+ D D P+L+ + L Sbjct: 90 LPNLRTIRLDNNLLS--GPLPPFFKLPGLKSLLLSNNSFSGEIAD-DFFKETPQLKRVFL 146 Query: 402 MHNPVANK 425 +N ++ K Sbjct: 147 DNNRLSGK 154 >At3g06060.1 68416.m00693 short-chain dehydrogenase/reductase (SDR) family protein contains INTERPRO family IPR002198 short-chain dehydrogenase/reductase (SDR) superfamily Length = 326 Score = 28.3 bits (60), Expect = 6.0 Identities = 13/36 (36%), Positives = 18/36 (50%) Frame = +3 Query: 492 KQKERDEANALFKSRKGKEIQREIAKKAKTFVPGGN 599 +QK R E A+ + G E+AKKA + GN Sbjct: 229 EQKSRPEVTAIIAASSGSMETEEVAKKAMDGIKAGN 264 >At2g46490.1 68415.m05786 expressed protein (APS2) identical to cDNA Aps2, partial cds GI:4519894 Length = 134 Score = 28.3 bits (60), Expect = 6.0 Identities = 17/34 (50%), Positives = 20/34 (58%) Frame = -2 Query: 253 NRIHFNLFSSGKPSSFLISLSEKSIVSN*SSVAP 152 N + NLFSS SS L SLS S +SN +S P Sbjct: 75 NIMAMNLFSSSSSSSNLQSLSSSSSLSNLASDLP 108 >At1g08290.1 68414.m00915 zinc finger (C2H2 type) protein (WIP3) identical to WIP3 protein [Arabidopsis thaliana] gi|18027014|gb|AAL55723; contains Pfam domain, PF00096: Zinc finger, C2H2 type Length = 337 Score = 28.3 bits (60), Expect = 6.0 Identities = 13/30 (43%), Positives = 16/30 (53%), Gaps = 1/30 (3%) Frame = -1 Query: 455 FECHICPIMVFV-GNWIVHE**CSQLW*CT 369 F C C + V G+W HE C +LW CT Sbjct: 265 FSCGKCGKALAVKGDWRTHEKNCGKLWYCT 294 >At1g02290.1 68414.m00171 expressed protein Length = 443 Score = 28.3 bits (60), Expect = 6.0 Identities = 17/62 (27%), Positives = 30/62 (48%), Gaps = 1/62 (1%) Frame = +3 Query: 465 LRLLDFRKIKQKERDEANALFKS-RKGKEIQREIAKKAKTFVPGGNMPDPKVTNLTPQEI 641 L+LLD ++ KE D A FK+ K ++R K+ TF G+ + +T + + Sbjct: 178 LKLLDLNRVPSKEMDSATCRFKTPNVVKPVERN-RSKSLTFPRSGSSKNSLKIKITKEGV 236 Query: 642 HK 647 + Sbjct: 237 FR 238 >At5g01690.1 68418.m00086 cation/hydrogen exchanger, putative (CHX27) monovalent cation:proton antiporter family 2 (CPA2) member, PMID:11500563 Length = 732 Score = 27.9 bits (59), Expect = 8.0 Identities = 12/22 (54%), Positives = 15/22 (68%) Frame = -3 Query: 201 YRCPRSLSYQIDRA*HPDFRFV 136 + CP S++ IDR PDFRFV Sbjct: 560 HNCPCSVALFIDRGRLPDFRFV 581 >At4g24760.1 68417.m03545 expressed protein Length = 365 Score = 27.9 bits (59), Expect = 8.0 Identities = 13/42 (30%), Positives = 25/42 (59%) Frame = +3 Query: 291 EHYIPNLESVILTNNNISELGDLDPLSTLPKLRTLSLMHNPV 416 E+Y E++IL ++ +D + LP+LR S++H+P+ Sbjct: 132 ENYGAKQENIILYGQSVGSGPTVDLAARLPRLRA-SILHSPI 172 >At3g20190.1 68416.m02559 leucine-rich repeat transmembrane protein kinase, putative similar to receptor kinase GB:AAA33715 [Petunia integrifolia] Length = 679 Score = 27.9 bits (59), Expect = 8.0 Identities = 11/19 (57%), Positives = 15/19 (78%) Frame = +3 Query: 354 DLDPLSTLPKLRTLSLMHN 410 DL+PL+ + LRTLS M+N Sbjct: 111 DLEPLAAIKNLRTLSFMNN 129 >At1g74180.1 68414.m08591 leucine-rich repeat family protein contains leucine rich-repeat (LRR) domains Pfam:PF00560, INTERPRO:IPR001611; similar to Hcr2-0B [Lycopersicon esculentum] gi|3894387|gb|AAC78593 Length = 951 Score = 27.9 bits (59), Expect = 8.0 Identities = 16/58 (27%), Positives = 32/58 (55%) Frame = +3 Query: 228 LKRLKCILLNNNRIVRIGENLEHYIPNLESVILTNNNISELGDLDPLSTLPKLRTLSL 401 L +L+ + L++N++ + + +LE + L++NN L+PL+ L KL+ L Sbjct: 258 LNKLRVLDLSSNQLSGNLPASFNSLESLEYLSLSDNNFEGFFSLNPLANLTKLKVFRL 315 >At1g70940.1 68414.m08184 auxin transport protein, putative (PIN3) similar to auxin transport protein [Arabidopsis thaliana] gi|5817301|gb|AAD52695 Length = 640 Score = 27.9 bits (59), Expect = 8.0 Identities = 9/25 (36%), Positives = 18/25 (72%) Frame = +2 Query: 632 SRNP*DPRSNQECIIPTGGRTSDQN 706 ++NP D +NQ+ +PTGG+++ + Sbjct: 328 NKNPKDVNTNQQTTLPTGGKSNSHD 352 >At1g56660.1 68414.m06516 expressed protein Length = 522 Score = 27.9 bits (59), Expect = 8.0 Identities = 16/51 (31%), Positives = 28/51 (54%) Frame = +3 Query: 408 NPVANKNHYRAYVAFKMPELRLLDFRKIKQKERDEANALFKSRKGKEIQRE 560 N A+K V+ + EL D +K K+KE+DE+ K +K K+ +++ Sbjct: 150 NKKADKEKKHEDVSQEKEELEEEDGKKNKKKEKDESGTEEKKKKPKKEKKQ 200 >At1g51220.1 68414.m05761 zinc finger (C2H2 type) protein (WIP5) identical to WIP5 protein [Arabidopsis thaliana] gi|18376498|emb|CAC86167; contains Pfam domain, PF00096: Zinc finger, C2H2 type Length = 337 Score = 27.9 bits (59), Expect = 8.0 Identities = 12/30 (40%), Positives = 16/30 (53%), Gaps = 1/30 (3%) Frame = -1 Query: 455 FECHICPIMVFV-GNWIVHE**CSQLW*CT 369 F C +C V G+W HE C +LW C+ Sbjct: 262 FACRMCGKAFAVKGDWRTHEKNCGKLWYCS 291 >At1g34790.1 68414.m04337 transparent testa 1 protein (TT1) / zinc finger (C2H2 type) protein TT1 identical to transparent testa 1 GI:18253279 from [Arabidopsis thaliana]; contains Pfam profile PF00096: Zinc finger, C2H2 type Length = 303 Score = 27.9 bits (59), Expect = 8.0 Identities = 11/29 (37%), Positives = 16/29 (55%), Gaps = 1/29 (3%) Frame = -1 Query: 455 FECHICPIMVFV-GNWIVHE**CSQLW*C 372 F C +C ++ V G+W HE C + W C Sbjct: 229 FSCRLCGKLLAVKGDWRTHEKNCGKRWVC 257 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,943,963 Number of Sequences: 28952 Number of extensions: 355373 Number of successful extensions: 1119 Number of sequences better than 10.0: 42 Number of HSP's better than 10.0 without gapping: 1066 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1116 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1746037600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -