BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_F_D01 (799 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_01_1209 - 9738501-9738516,9738703-9739161,9739389-9739608,973... 29 3.2 06_01_0277 - 2039129-2040280 28 9.9 02_02_0574 - 11701359-11701460,11701469-11701570,11701725-117019... 28 9.9 >01_01_1209 - 9738501-9738516,9738703-9739161,9739389-9739608, 9739708-9739831,9739927-9740635,9741826-9742132, 9742213-9743704 Length = 1108 Score = 29.5 bits (63), Expect = 3.2 Identities = 16/43 (37%), Positives = 24/43 (55%) Frame = +2 Query: 332 IIIVNFNYGAIYVLKPFWFVIYSPF*REIFTQIWCTSVALYNI 460 +I+ NF A +VL FW+V+Y+ F + T I S LY + Sbjct: 934 MILYNFYKNATFVLVLFWYVLYTAF--TLTTAITEWSSLLYTV 974 >06_01_0277 - 2039129-2040280 Length = 383 Score = 27.9 bits (59), Expect = 9.9 Identities = 9/35 (25%), Positives = 23/35 (65%) Frame = +1 Query: 688 MHLIFFNVFQTIKVGGIMFTEFFLSIIXDKRQLII 792 + F+V + ++VGG+++ + +L ++RQL++ Sbjct: 309 LEFFMFDVDRVLRVGGLLWIDSYLCQSEERRQLVV 343 >02_02_0574 - 11701359-11701460,11701469-11701570,11701725-11701922, 11702090-11704052,11705312-11706126 Length = 1059 Score = 27.9 bits (59), Expect = 9.9 Identities = 17/55 (30%), Positives = 26/55 (47%), Gaps = 1/55 (1%) Frame = +2 Query: 497 QLRIIMRKENTALWKVTYSN-LISTYLICSKM*FIYVHNRITDIIKITITVCPPR 658 +LRI+ E+T W +Y N LI + K+ +Y+H I+ C PR Sbjct: 688 ELRILQISESTGAWHDSYENTLIDSLCNLHKICDLYIHGCKLSTEFISNIRCSPR 742 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,915,242 Number of Sequences: 37544 Number of extensions: 404254 Number of successful extensions: 636 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 626 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 636 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2162420256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -