BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_F_C22 (834 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_18582| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.87 SB_8363| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.0 SB_21838| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.7 SB_30749| Best HMM Match : FARP (HMM E-Value=0.032) 29 6.1 >SB_18582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 499 Score = 31.5 bits (68), Expect = 0.87 Identities = 19/44 (43%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Frame = +3 Query: 318 EDKLKVEKLIDACLANKGNSPHQTAWNYVKCYHEKDPK-HALFL 446 E+ + V KL D L NKG PH N ++E DPK H LF+ Sbjct: 341 EESVDVTKL-DYYLMNKGYIPHADRLNDTLHHYETDPKYHRLFI 383 >SB_8363| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 776 Score = 30.3 bits (65), Expect = 2.0 Identities = 15/44 (34%), Positives = 23/44 (52%) Frame = -1 Query: 222 SMVRFQS*SRLSSVCSPIVHQLSSRRDSRLCVSSSSPSAHL*GP 91 S + +S S SSVC ++H+LS+ R +C S A+ P Sbjct: 430 SYIVCRSISYTSSVCRSVIHRLSANRSKTVCRSIGHTGAYTGAP 473 >SB_21838| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 949 Score = 29.9 bits (64), Expect = 2.7 Identities = 14/47 (29%), Positives = 25/47 (53%) Frame = -3 Query: 733 LLAAYLCMR*KKSPRSIKRDKQSYDEHKRKLNFISRLNMLKQQNKIY 593 L+A LC R S ++ + Q D HK+ L +++M ++Q + Y Sbjct: 768 LMACLLCKRQLPSREALDKHMQFSDLHKQNLEIHKKMSMTEEQREEY 814 >SB_30749| Best HMM Match : FARP (HMM E-Value=0.032) Length = 2565 Score = 28.7 bits (61), Expect = 6.1 Identities = 20/67 (29%), Positives = 38/67 (56%), Gaps = 1/67 (1%) Frame = +2 Query: 479 LISVK*LGRVYLDDIMIISENIAILYGVIILTLIYIC-SINFVLLF*HIQSRNEI*FSFV 655 +IS+ + +++ I++I I I+ +II+T+I I +I F+++ I I + Sbjct: 2154 IISIIVIIVIFIVIIIVIVLTITIIIAIIIVTIIVITINIIFIVIVIIISIIGIIIVIII 2213 Query: 656 FIIALFI 676 FII +FI Sbjct: 2214 FIIVIFI 2220 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,283,925 Number of Sequences: 59808 Number of extensions: 494517 Number of successful extensions: 1267 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1176 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1263 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2347493764 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -