BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_F_C22 (834 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value L06237-1|AAA18904.1| 2468|Homo sapiens microtubule-associated pr... 33 0.96 BC122869-1|AAI22870.1| 470|Homo sapiens G protein-coupled recep... 33 1.7 BC119779-1|AAI19780.1| 470|Homo sapiens G protein-coupled recep... 33 1.7 AY569571-1|AAS76893.1| 470|Homo sapiens G protein-coupled recep... 33 1.7 AB083620-1|BAB89333.1| 470|Homo sapiens putative G-protein coup... 33 1.7 AB065853-1|BAC06071.1| 470|Homo sapiens seven transmembrane hel... 33 1.7 BC100937-1|AAI00938.1| 301|Homo sapiens solute carrier family 2... 30 9.0 >L06237-1|AAA18904.1| 2468|Homo sapiens microtubule-associated protein 1B protein. Length = 2468 Score = 33.5 bits (73), Expect = 0.96 Identities = 22/78 (28%), Positives = 37/78 (47%) Frame = +3 Query: 108 QKENLKKHRADCLSETKADEQLVNKLKTGDFKTENEPLKKYALCMLIKSQLMTKDGKFKK 287 +KE K+ + + E K ++ + KL D K + PL + +K ++ K+ KK Sbjct: 710 KKEVKKEEKKEVKKEEKEPKKEIKKLPK-DAKKSSTPLSEAKKPAALKPKVPKKEESVKK 768 Query: 288 DVALAKVPNAEDKLKVEK 341 D A P + K+KV K Sbjct: 769 DSVAAGKPKEKGKIKVIK 786 >BC122869-1|AAI22870.1| 470|Homo sapiens G protein-coupled receptor 152 protein. Length = 470 Score = 32.7 bits (71), Expect = 1.7 Identities = 21/56 (37%), Positives = 27/56 (48%) Frame = -2 Query: 197 VACLQFVHQLFISFRLGETVGSVFLQVLLLLICEGLSQDNADDEHDKXLHDALCLG 30 V CL F +S R+ E +G FL LLLL+C L+Q A + A C G Sbjct: 180 VICLDFWDSEELSLRMLEVLGG-FLPFLLLLVCHVLTQATACRTCHRQQQPAACRG 234 >BC119779-1|AAI19780.1| 470|Homo sapiens G protein-coupled receptor 152 protein. Length = 470 Score = 32.7 bits (71), Expect = 1.7 Identities = 21/56 (37%), Positives = 27/56 (48%) Frame = -2 Query: 197 VACLQFVHQLFISFRLGETVGSVFLQVLLLLICEGLSQDNADDEHDKXLHDALCLG 30 V CL F +S R+ E +G FL LLLL+C L+Q A + A C G Sbjct: 180 VICLDFWDSEELSLRMLEVLGG-FLPFLLLLVCHVLTQATACRTCHRQQQPAACRG 234 >AY569571-1|AAS76893.1| 470|Homo sapiens G protein-coupled receptor 152 protein. Length = 470 Score = 32.7 bits (71), Expect = 1.7 Identities = 21/56 (37%), Positives = 27/56 (48%) Frame = -2 Query: 197 VACLQFVHQLFISFRLGETVGSVFLQVLLLLICEGLSQDNADDEHDKXLHDALCLG 30 V CL F +S R+ E +G FL LLLL+C L+Q A + A C G Sbjct: 180 VICLDFWDSEELSLRMLEVLGG-FLPFLLLLVCHVLTQATACRTCHRQQQPAACRG 234 >AB083620-1|BAB89333.1| 470|Homo sapiens putative G-protein coupled receptor protein. Length = 470 Score = 32.7 bits (71), Expect = 1.7 Identities = 21/56 (37%), Positives = 27/56 (48%) Frame = -2 Query: 197 VACLQFVHQLFISFRLGETVGSVFLQVLLLLICEGLSQDNADDEHDKXLHDALCLG 30 V CL F +S R+ E +G FL LLLL+C L+Q A + A C G Sbjct: 180 VICLDFWDSEELSLRMLEVLGG-FLPFLLLLVCHVLTQATACRTCHRQQQPAACRG 234 >AB065853-1|BAC06071.1| 470|Homo sapiens seven transmembrane helix receptor protein. Length = 470 Score = 32.7 bits (71), Expect = 1.7 Identities = 21/56 (37%), Positives = 27/56 (48%) Frame = -2 Query: 197 VACLQFVHQLFISFRLGETVGSVFLQVLLLLICEGLSQDNADDEHDKXLHDALCLG 30 V CL F +S R+ E +G FL LLLL+C L+Q A + A C G Sbjct: 180 VICLDFWDSEELSLRMLEVLGG-FLPFLLLLVCHVLTQATACRTCHRQQQPAACRG 234 >BC100937-1|AAI00938.1| 301|Homo sapiens solute carrier family 25 (mitochondrial carrier; ornithine transporter) member protein. Length = 301 Score = 30.3 bits (65), Expect = 9.0 Identities = 14/44 (31%), Positives = 23/44 (52%) Frame = +3 Query: 294 ALAKVPNAEDKLKVEKLIDACLANKGNSPHQTAWNYVKCYHEKD 425 ALA P K +++ + + ++ K H T W+ VKC +KD Sbjct: 121 ALALCPTELVKCRLQTMYEMEMSGKIAKSHNTIWSVVKCILKKD 164 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 111,990,412 Number of Sequences: 237096 Number of extensions: 2342016 Number of successful extensions: 4762 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 4449 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4762 length of database: 76,859,062 effective HSP length: 89 effective length of database: 55,757,518 effective search space used: 10482413384 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -