BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_F_C22 (834 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g08310.1 68417.m01372 expressed protein glutamic acid-rich pr... 32 0.54 At4g19230.2 68417.m02837 cytochrome P450 family protein cytochro... 31 0.71 At5g17930.1 68418.m02102 MA3 domain-containing protein low simil... 31 1.2 At5g17240.1 68418.m02020 SET domain-containing protein contains ... 29 3.8 At4g02710.1 68417.m00366 kinase interacting family protein simil... 29 5.0 At3g20860.1 68416.m02637 protein kinase family protein contains ... 29 5.0 At1g80410.1 68414.m09413 acetyltransferase-related low similarit... 29 5.0 At5g64710.2 68418.m08135 expressed protein contains Pfam profile... 28 6.6 At5g64710.1 68418.m08134 expressed protein contains Pfam profile... 28 6.6 At5g31412.1 68418.m03722 hypothetical protein contains Pfam doma... 28 6.6 At3g04810.2 68416.m00521 protein kinase, putative similar to LST... 28 6.6 At3g04810.1 68416.m00520 protein kinase, putative similar to LST... 28 6.6 At1g66130.1 68414.m07505 oxidoreductase N-terminal domain-contai... 28 6.6 At5g28290.1 68418.m03434 protein kinase, putative similar to LST... 28 8.8 At2g37050.1 68415.m04546 leucine-rich repeat family protein / pr... 28 8.8 >At4g08310.1 68417.m01372 expressed protein glutamic acid-rich protein precursor - Plasmodium falciparum, PIR2:A54514 Length = 504 Score = 31.9 bits (69), Expect = 0.54 Identities = 21/59 (35%), Positives = 30/59 (50%) Frame = +3 Query: 102 DEQKENLKKHRADCLSETKADEQLVNKLKTGDFKTENEPLKKYALCMLIKSQLMTKDGK 278 D K +K+H CL+ + DE N L+T + K + P+K+ A L K KDGK Sbjct: 77 DVHKSFVKQHLVQCLAGAENDETSENSLET-EKKDDVTPVKEAA--ELSKEHTTKKDGK 132 >At4g19230.2 68417.m02837 cytochrome P450 family protein cytochrome P450, Arabidopsis thaliana; supported by cDNA: gi_15293092_gb_AY050980.1_ Length = 484 Score = 31.5 bits (68), Expect = 0.71 Identities = 16/32 (50%), Positives = 19/32 (59%) Frame = -1 Query: 438 ERASGLSRGSISHNSRLFGEGCCLCWPGKRQS 343 ERA+G S G +SR C LCWPG R+S Sbjct: 439 ERATGFSMG----HSRFPKTDCPLCWPGSRRS 466 >At5g17930.1 68418.m02102 MA3 domain-containing protein low similarity to SP|Q9P6R9 Cell cycle control protein cwf22 {Schizosaccharomyces pombe}; contains Pfam profile PF02847: MA3 domain Length = 707 Score = 30.7 bits (66), Expect = 1.2 Identities = 25/104 (24%), Positives = 47/104 (45%), Gaps = 2/104 (1%) Frame = +3 Query: 135 ADCLSETKADE--QLVNKLKTGDFKTENEPLKKYALCMLIKSQLMTKDGKFKKDVALAKV 308 A+ ++ET E + LK + + N +K C+++ S+ F+K + L + Sbjct: 479 AEDIAETMDAEVVEAQKMLKLAEAQRMNTDSRKAIFCVIMSSEDYID--AFEKLLRL-DL 535 Query: 309 PNAEDKLKVEKLIDACLANKGNSPHQTAWNYVKCYHEKDPKHAL 440 P +D+ + L++ CL K + T C H+K+ K L Sbjct: 536 PGKQDREIMRVLVECCLQEKAFNKFYTVLASKLCEHDKNHKFTL 579 >At5g17240.1 68418.m02020 SET domain-containing protein contains Pfam profile PF00856: SET domain Length = 491 Score = 29.1 bits (62), Expect = 3.8 Identities = 17/67 (25%), Positives = 32/67 (47%), Gaps = 1/67 (1%) Frame = +3 Query: 219 LKKYALCMLI-KSQLMTKDGKFKKDVALAKVPNAEDKLKVEKLIDACLANKGNSPHQTAW 395 LKK L + + + LMT + KD+ L+ N + L +++ CL + + ++ W Sbjct: 57 LKKGELVLKVPRKALMTTESIIAKDLKLSDAVNLHNSLSSTQILSVCLLYEMSKEKKSFW 116 Query: 396 NYVKCYH 416 Y +H Sbjct: 117 -YPYLFH 122 >At4g02710.1 68417.m00366 kinase interacting family protein similar to kinase interacting protein 1 (GI:13936326) [Petunia integrifolia] Length = 1111 Score = 28.7 bits (61), Expect = 5.0 Identities = 14/31 (45%), Positives = 19/31 (61%) Frame = -1 Query: 459 DYVFTRKERASGLSRGSISHNSRLFGEGCCL 367 DYVFT +E A +S+G+ + L EG CL Sbjct: 781 DYVFTHRESAGEVSKGADLMDEFLKLEGMCL 811 >At3g20860.1 68416.m02637 protein kinase family protein contains protein kinase domain, Pfam:PF00069; contains serine/threonine protein kinase domain, INTERPRO:IPR002290 Length = 427 Score = 28.7 bits (61), Expect = 5.0 Identities = 23/85 (27%), Positives = 37/85 (43%), Gaps = 1/85 (1%) Frame = +3 Query: 72 VCVVLAQALTDEQKENLKKHRADCLSETKADEQLVNKLKTGDFKTENEPLKKYALCMLIK 251 VC+V + + + +KK R SE K +V L D+ N L + C I Sbjct: 87 VCIVTSYCEGGDMTQMIKKSRGVFASEEKLCRWMVQLLLAIDYLHNNRVLHRDLKCSNI- 145 Query: 252 SQLMTKDGKFK-KDVALAKVPNAED 323 +TK+ + + D LAK+ +D Sbjct: 146 --FLTKENEVRLGDFGLAKLLGKDD 168 >At1g80410.1 68414.m09413 acetyltransferase-related low similarity to acetyltransferase Tubedown-1 [Mus musculus] GI:8497318, N-TERMINAL ACETYLTRANSFERASE GB:P12945 from (Saccharomyces cerevisiae); contains Pfam profile PF00515 TPR Domain Length = 897 Score = 28.7 bits (61), Expect = 5.0 Identities = 14/38 (36%), Positives = 26/38 (68%) Frame = -3 Query: 703 KKSPRSIKRDKQSYDEHKRKLNFISRLNMLKQQNKIYR 590 KK P+ + DK SY E ++++ +S++ L++ NK+YR Sbjct: 214 KKEPKIV--DKLSYKE--QEVSLLSKVGRLEEANKLYR 247 >At5g64710.2 68418.m08135 expressed protein contains Pfam profile PF04396: Protein of unknown function, DUF537 Length = 716 Score = 28.3 bits (60), Expect = 6.6 Identities = 19/73 (26%), Positives = 32/73 (43%), Gaps = 3/73 (4%) Frame = +3 Query: 78 VVLAQALTDEQKENLKKHRADCLSETKADEQLVNKLKTGDFKTENEPLKKYALCMLI--- 248 VV + + K+N K + + ++ ++ V +K D K + EP+K L + Sbjct: 237 VVSVEKMCQNMKQNDKDVKEESHQLQESSQEFVQVMKLMDVKAKEEPVKANQLAITAVDD 296 Query: 249 KSQLMTKDGKFKK 287 S KDG KK Sbjct: 297 VSSFEEKDGFLKK 309 >At5g64710.1 68418.m08134 expressed protein contains Pfam profile PF04396: Protein of unknown function, DUF537 Length = 841 Score = 28.3 bits (60), Expect = 6.6 Identities = 19/73 (26%), Positives = 32/73 (43%), Gaps = 3/73 (4%) Frame = +3 Query: 78 VVLAQALTDEQKENLKKHRADCLSETKADEQLVNKLKTGDFKTENEPLKKYALCMLI--- 248 VV + + K+N K + + ++ ++ V +K D K + EP+K L + Sbjct: 362 VVSVEKMCQNMKQNDKDVKEESHQLQESSQEFVQVMKLMDVKAKEEPVKANQLAITAVDD 421 Query: 249 KSQLMTKDGKFKK 287 S KDG KK Sbjct: 422 VSSFEEKDGFLKK 434 >At5g31412.1 68418.m03722 hypothetical protein contains Pfam domain, PF04937: Protein of unknown function (DUF 659) Length = 433 Score = 28.3 bits (60), Expect = 6.6 Identities = 20/64 (31%), Positives = 31/64 (48%), Gaps = 2/64 (3%) Frame = +3 Query: 129 HRADCLSETKADEQLVNKLKT-GDFKTENEPLKKYALCMLIKSQLMTKD-GKFKKDVALA 302 H D + E + + K++T GD+K EN L +Y C+L + +D G K + LA Sbjct: 227 HTVDLMLEAISKLPKMGKMQTFGDYKGENLFLNRYESCVLEWCDVCVEDFGPLMKLLRLA 286 Query: 303 KVPN 314 N Sbjct: 287 DGEN 290 >At3g04810.2 68416.m00521 protein kinase, putative similar to LSTK-1-like kinase [Lycopersicon esculentum] GI:15637110; contains Pfam profile: PF00069 Eukaryotic protein kinase domain Length = 578 Score = 28.3 bits (60), Expect = 6.6 Identities = 23/85 (27%), Positives = 37/85 (43%), Gaps = 1/85 (1%) Frame = +3 Query: 72 VCVVLAQALTDEQKENLKKHRADCLSETKADEQLVNKLKTGDFKTENEPLKKYALCMLIK 251 VC+++ + E +KK +E K + LV L ++ N L + C I Sbjct: 77 VCIIIGYCKGGDMAEAIKKTNGVHFTEEKLCKWLVQILLALEYLHANHILHRDVKCSNI- 135 Query: 252 SQLMTKDGKFK-KDVALAKVPNAED 323 +TKD + D LAKV ++D Sbjct: 136 --FLTKDQDIRLGDFGLAKVLTSDD 158 >At3g04810.1 68416.m00520 protein kinase, putative similar to LSTK-1-like kinase [Lycopersicon esculentum] GI:15637110; contains Pfam profile: PF00069 Eukaryotic protein kinase domain Length = 606 Score = 28.3 bits (60), Expect = 6.6 Identities = 23/85 (27%), Positives = 37/85 (43%), Gaps = 1/85 (1%) Frame = +3 Query: 72 VCVVLAQALTDEQKENLKKHRADCLSETKADEQLVNKLKTGDFKTENEPLKKYALCMLIK 251 VC+++ + E +KK +E K + LV L ++ N L + C I Sbjct: 77 VCIIIGYCKGGDMAEAIKKTNGVHFTEEKLCKWLVQILLALEYLHANHILHRDVKCSNI- 135 Query: 252 SQLMTKDGKFK-KDVALAKVPNAED 323 +TKD + D LAKV ++D Sbjct: 136 --FLTKDQDIRLGDFGLAKVLTSDD 158 >At1g66130.1 68414.m07505 oxidoreductase N-terminal domain-containing protein similar to AX110P [Daucus carota] GI:285739; contains Pfam profile PF01408: Oxidoreductase family NAD-binding Rossmann fold Length = 364 Score = 28.3 bits (60), Expect = 6.6 Identities = 13/38 (34%), Positives = 20/38 (52%) Frame = +3 Query: 282 KKDVALAKVPNAEDKLKVEKLIDACLANKGNSPHQTAW 395 KK L + P A+D ++EK+++AC N T W Sbjct: 95 KKKHVLVEKPPAQDATELEKIVEACEYNGVQFMDGTIW 132 >At5g28290.1 68418.m03434 protein kinase, putative similar to LSTK-1-like kinase [Lycopersicon esculentum] GI:15637110; contains Pfam profile: PF00069 Eukaryotic protein kinase domain Length = 568 Score = 27.9 bits (59), Expect = 8.8 Identities = 23/85 (27%), Positives = 37/85 (43%), Gaps = 1/85 (1%) Frame = +3 Query: 72 VCVVLAQALTDEQKENLKKHRADCLSETKADEQLVNKLKTGDFKTENEPLKKYALCMLIK 251 VC+V+ + E +KK SE K + LV L ++ + L + C I Sbjct: 77 VCIVIGYCKGGDMAEAIKKANGVEFSEEKLCKWLVQLLMALEYLHASHILHRDVKCSNI- 135 Query: 252 SQLMTKDGKFK-KDVALAKVPNAED 323 +TKD + D LAK+ ++D Sbjct: 136 --FLTKDQDIRLGDFGLAKILTSDD 158 >At2g37050.1 68415.m04546 leucine-rich repeat family protein / protein kinase family protein contains Pfam domains PF00560: Leucine Rich Repeat and PF00069: Protein kinase domain Length = 934 Score = 27.9 bits (59), Expect = 8.8 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = -2 Query: 734 AASCLSLYEMKEITKKHQTR 675 AA C +LYE++E TKK + R Sbjct: 590 AAHCFTLYEIEEATKKFEKR 609 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,046,989 Number of Sequences: 28952 Number of extensions: 348912 Number of successful extensions: 864 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 846 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 864 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1921616800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -