BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_F_C18 (804 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ535208-1|CAD59408.1| 1133|Anopheles gambiae SMC6 protein protein. 28 0.39 CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskel... 27 0.90 AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. 24 4.8 AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. 24 4.8 >AJ535208-1|CAD59408.1| 1133|Anopheles gambiae SMC6 protein protein. Length = 1133 Score = 27.9 bits (59), Expect = 0.39 Identities = 16/53 (30%), Positives = 28/53 (52%), Gaps = 3/53 (5%) Frame = +1 Query: 499 RKYIQNYAVIARPLTDMLRKDKKFEFNNEHRLVFNM---LKEKLTSKPVLKIY 648 R + Y+ R LT M+R +K F++ H+L +M +K K T+ ++ Y Sbjct: 947 RDELIRYSTALRDLTQMMRDIRKSRFSHLHKLTTHMALRVKHKFTNIMQIRNY 999 >CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskeletal structural protein protein. Length = 1645 Score = 26.6 bits (56), Expect = 0.90 Identities = 10/33 (30%), Positives = 20/33 (60%) Frame = +2 Query: 413 RERQMLSLNFLSREMRSNYKVS*DFVPILENTY 511 R++ + ++NF+ RE + ++ + PIL TY Sbjct: 1402 RDQALKAINFIEREQQQEMEIFEETKPILTTTY 1434 >AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. Length = 3320 Score = 24.2 bits (50), Expect = 4.8 Identities = 9/24 (37%), Positives = 16/24 (66%) Frame = +1 Query: 595 VFNMLKEKLTSKPVLKIYEPKAET 666 +FN + KLTS PV ++++ + T Sbjct: 1161 LFNFQRNKLTSLPVGEVFDTNSNT 1184 >AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. Length = 3318 Score = 24.2 bits (50), Expect = 4.8 Identities = 9/24 (37%), Positives = 16/24 (66%) Frame = +1 Query: 595 VFNMLKEKLTSKPVLKIYEPKAET 666 +FN + KLTS PV ++++ + T Sbjct: 1162 LFNFQRNKLTSLPVGEVFDTNSNT 1185 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 725,168 Number of Sequences: 2352 Number of extensions: 13786 Number of successful extensions: 22 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 84823812 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -