SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fcaL-P02_F_C13
         (495 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY578801-1|AAT07306.1|  506|Anopheles gambiae dSmad2 protein.          23   5.7  
AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 pr...    22   10.0 

>AY578801-1|AAT07306.1|  506|Anopheles gambiae dSmad2 protein.
          Length = 506

 Score = 23.0 bits (47), Expect = 5.7
 Identities = 16/64 (25%), Positives = 26/64 (40%)
 Frame = +1

Query: 7   ADDSKTDSCVEESYSKLP*ST**LLYLRIARREQKLKEHGASSCISGKRGRRCCNIWHWG 186
           A   K  S +EE    L   +     + I+R    + E+G +    G     CC +W W 
Sbjct: 37  AKKMKKSSALEELERALTAQSSHTKCIPISRNASAIGENGVA-LKKGLPHVICCRLWRWP 95

Query: 187 SVDS 198
            ++S
Sbjct: 96  DLNS 99


>AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1
           precursor protein.
          Length = 1623

 Score = 22.2 bits (45), Expect = 10.0
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = -3

Query: 403 NRKGPILERCRE 368
           NR GP  ERC+E
Sbjct: 373 NRDGPNCERCKE 384


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 463,022
Number of Sequences: 2352
Number of extensions: 9082
Number of successful extensions: 11
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 11
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 11
length of database: 563,979
effective HSP length: 60
effective length of database: 422,859
effective search space used: 43977336
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -