BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_F_C06 (763 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY183375-1|AAO24765.1| 679|Anopheles gambiae NADPH cytochrome P... 25 3.4 AY578803-1|AAT07308.1| 474|Anopheles gambiae mothers against Dp... 24 4.5 >AY183375-1|AAO24765.1| 679|Anopheles gambiae NADPH cytochrome P450 reductase protein. Length = 679 Score = 24.6 bits (51), Expect = 3.4 Identities = 15/41 (36%), Positives = 22/41 (53%), Gaps = 2/41 (4%) Frame = +3 Query: 78 KMAYDLKKEDEVKDYIEN--IGIEYRFGCYKEQKPEVCHLL 194 K + D EDE++DY + I + F +E+K V HLL Sbjct: 570 KRSEDYIYEDELEDYSKRGIINLRVAFSRDQEKKVYVTHLL 610 >AY578803-1|AAT07308.1| 474|Anopheles gambiae mothers against Dpp protein. Length = 474 Score = 24.2 bits (50), Expect = 4.5 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = +3 Query: 657 CELGNMFACANVSLMYKKGDGVEKNQDESXRF 752 C +G +F C N S++ DG + S RF Sbjct: 290 CRVGEVFHCTNTSIIV---DGFTNPSNNSDRF 318 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 722,652 Number of Sequences: 2352 Number of extensions: 15841 Number of successful extensions: 38 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 38 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 38 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 79002570 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -