BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_F_B24 (769 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC2D10.17 |clr1||cryptic loci regulator Clr1|Schizosaccharomyc... 31 0.24 SPBC21C3.03 |||ABC1 kinase family protein|Schizosaccharomyces po... 28 1.3 SPAC688.12c |||sequence orphan|Schizosaccharomyces pombe|chr 1||... 27 3.0 SPCC23B6.04c |||sec14 cytosolic factor family|Schizosaccharomyce... 27 3.0 SPBC19C2.09 |sre1||sterol regulatory element binding protein Sre... 26 5.2 SPAC1486.10 |thi1|ntf1, SPAC6G10.01|transcription factor Thi1|Sc... 26 6.8 SPAC23C11.04c |pnk1||DNA kinase/phosphatase Pnk1|Schizosaccharom... 25 9.0 SPBC25B2.07c |mug164||microtubule-associated protein|Schizosacch... 25 9.0 SPAPB17E12.02 |yip12|yip1, yip1-b|SMN family protein Yip12|Schiz... 25 9.0 SPAC19B12.12c |yip11|yip1, yip1-a|SMN family protein Yip11|Schiz... 25 9.0 >SPBC2D10.17 |clr1||cryptic loci regulator Clr1|Schizosaccharomyces pombe|chr 2|||Manual Length = 1238 Score = 30.7 bits (66), Expect = 0.24 Identities = 17/45 (37%), Positives = 26/45 (57%) Frame = -3 Query: 320 SMSRRTCLDSPTFNTATGSFTASCSDMASTCITFNSSGLASGPNN 186 S+S T L P+ +T S+ + +++ T +F SSGL SGP N Sbjct: 548 SVSSETTLVKPS---STSSYIDTTNNVLKTNSSFKSSGLTSGPRN 589 >SPBC21C3.03 |||ABC1 kinase family protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 674 Score = 28.3 bits (60), Expect = 1.3 Identities = 15/52 (28%), Positives = 28/52 (53%), Gaps = 2/52 (3%) Frame = +1 Query: 217 LNVIQVEAMSLQ--EAVKLPVAVLKVGESRHVRLDIEFPDAPVTFTLVQGSG 366 LN IQ +SL+ + + V+ + HVR++ F + ++ LV+G+G Sbjct: 556 LNEIQKSTLSLKSLQIGTILQEVMTMAREHHVRIEANFANTVLSILLVEGAG 607 >SPAC688.12c |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 167 Score = 27.1 bits (57), Expect = 3.0 Identities = 12/37 (32%), Positives = 19/37 (51%) Frame = +2 Query: 464 EMILSSRMMRIKEKEQGSASRMRMKIMKKVNPRAKKR 574 E +L+ R R+KE+ + + K KK R KK+ Sbjct: 130 EALLAERKQRLKEQREKKEQKKEQKKEKKTERRKKKK 166 >SPCC23B6.04c |||sec14 cytosolic factor family|Schizosaccharomyces pombe|chr 3|||Manual Length = 1008 Score = 27.1 bits (57), Expect = 3.0 Identities = 14/41 (34%), Positives = 24/41 (58%), Gaps = 1/41 (2%) Frame = -3 Query: 350 RVNV-TGASGNSMSRRTCLDSPTFNTATGSFTASCSDMAST 231 R NV T ++ N + + + +PT +T TGS ++ S M +T Sbjct: 57 RPNVSTSSTSNEVRKSVPVGNPTVHTKTGSSSSPASKMRNT 97 >SPBC19C2.09 |sre1||sterol regulatory element binding protein Sre1|Schizosaccharomyces pombe|chr 2|||Manual Length = 900 Score = 26.2 bits (55), Expect = 5.2 Identities = 17/49 (34%), Positives = 26/49 (53%) Frame = +1 Query: 100 LSSSHQSETWDPEAKAEYPRSNKLVIRQALLGPDAKPDELNVIQVEAMS 246 L +S ++ + + AE KL+ Q L+G DAK D L ++ V A S Sbjct: 536 LYTSSENWVYSEQQLAEVRNMEKLLDAQ-LMGGDAKVDRLRLLMVFASS 583 >SPAC1486.10 |thi1|ntf1, SPAC6G10.01|transcription factor Thi1|Schizosaccharomyces pombe|chr 1|||Manual Length = 775 Score = 25.8 bits (54), Expect = 6.8 Identities = 12/43 (27%), Positives = 23/43 (53%) Frame = +3 Query: 105 IITSVRDMGSRGKSRIPTQQQARHSSSIVRSRCQTR*IKCDTG 233 + V+D+ + K R+P +Q+ R + C+ + IKC+ G Sbjct: 12 LFADVKDLERKKKRRVPPEQRRRVFRAC--KHCRQKKIKCNGG 52 >SPAC23C11.04c |pnk1||DNA kinase/phosphatase Pnk1|Schizosaccharomyces pombe|chr 1|||Manual Length = 421 Score = 25.4 bits (53), Expect = 9.0 Identities = 14/49 (28%), Positives = 25/49 (51%) Frame = +1 Query: 133 PEAKAEYPRSNKLVIRQALLGPDAKPDELNVIQVEAMSLQEAVKLPVAV 279 P+ KA Y + LVI G KP + Q++ ++ E++ LP+ + Sbjct: 104 PKLKALYQDNYSLVIFSNQNGIPRKPSAGHTFQMKIRAIFESLDLPIVL 152 >SPBC25B2.07c |mug164||microtubule-associated protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 501 Score = 25.4 bits (53), Expect = 9.0 Identities = 13/38 (34%), Positives = 18/38 (47%) Frame = -3 Query: 383 PIKCTGPEP*TRVNVTGASGNSMSRRTCLDSPTFNTAT 270 P + + P +RVNVT ASG+ T N +T Sbjct: 240 PTRTSTTRPLSRVNVTNASGSISKNSTSPSKVKVNAST 277 >SPAPB17E12.02 |yip12|yip1, yip1-b|SMN family protein Yip12|Schizosaccharomyces pombe|chr 1|||Manual Length = 235 Score = 25.4 bits (53), Expect = 9.0 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = -2 Query: 171 ELVAAWVFCFCLWIP 127 +L + W+FCFC +P Sbjct: 170 DLQSQWIFCFCYKLP 184 >SPAC19B12.12c |yip11|yip1, yip1-a|SMN family protein Yip11|Schizosaccharomyces pombe|chr 1|||Manual Length = 235 Score = 25.4 bits (53), Expect = 9.0 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = -2 Query: 171 ELVAAWVFCFCLWIP 127 +L + W+FCFC +P Sbjct: 170 DLQSQWIFCFCYKLP 184 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,808,612 Number of Sequences: 5004 Number of extensions: 52019 Number of successful extensions: 128 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 122 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 128 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 369323696 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -