BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_F_B24 (769 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g14850.1 68415.m01687 expressed protein 31 1.1 At5g18760.1 68418.m02228 zinc finger (C3HC4-type RING finger) fa... 29 4.5 At3g58050.1 68416.m06471 expressed protein 28 6.0 At4g33890.2 68417.m04809 expressed protein 28 7.9 At4g33890.1 68417.m04808 expressed protein 28 7.9 At3g14000.2 68416.m01768 expressed protein 28 7.9 At3g14000.1 68416.m01767 expressed protein 28 7.9 >At2g14850.1 68415.m01687 expressed protein Length = 291 Score = 30.7 bits (66), Expect = 1.1 Identities = 19/50 (38%), Positives = 26/50 (52%) Frame = +1 Query: 157 RSNKLVIRQALLGPDAKPDELNVIQVEAMSLQEAVKLPVAVLKVGESRHV 306 RS K R + LGP KP L E+MS +A +LP+ V+ V + V Sbjct: 104 RSRKFRDRPSPLGPLGKPQSLTTTNDESMS--KAQRLPMEVVSVEDGEEV 151 >At5g18760.1 68418.m02228 zinc finger (C3HC4-type RING finger) family protein predicted proteins, Arabidopsis thaliana ; contains Pfam profile PF00097: Zinc finger, C3HC4 type (RING finger) Length = 411 Score = 28.7 bits (61), Expect = 4.5 Identities = 17/77 (22%), Positives = 39/77 (50%), Gaps = 4/77 (5%) Frame = -3 Query: 308 RTCLDSPTFNTATGSFTASCSDMASTCIT----FNSSGLASGPNNA*RMTSLLLRGYSAF 141 + CL P+ N+A S S + +++ + N GL + + + M +++R S Sbjct: 110 KRCLSLPSSNSAKLSLVVSTTPVSAVVHSEQPKSNKDGLHASVSRSLSMNRVIVRAVSFD 169 Query: 140 ASGSHVSD*CDDERVTP 90 + +H+S+ + +++TP Sbjct: 170 DNKNHISNEANGDQITP 186 >At3g58050.1 68416.m06471 expressed protein Length = 1209 Score = 28.3 bits (60), Expect = 6.0 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = +1 Query: 97 TLSSSHQSETWDPEAKAEYPRSN 165 T S H + W+P +YPRSN Sbjct: 834 TRDSLHSKQVWEPMEPKKYPRSN 856 >At4g33890.2 68417.m04809 expressed protein Length = 342 Score = 27.9 bits (59), Expect = 7.9 Identities = 23/58 (39%), Positives = 27/58 (46%), Gaps = 8/58 (13%) Frame = +1 Query: 157 RSNKLVIRQALLGPDAKPDELNVIQVEAMS-LQEAVKL-------PVAVLKVGESRHV 306 RS KL R + LGP KP L E+MS Q A +L PV V+ V E V Sbjct: 121 RSRKLRDRPSPLGPLGKPHSLTTTNEESMSKAQSATELLSLGSRPPVEVVSVEEGEEV 178 >At4g33890.1 68417.m04808 expressed protein Length = 342 Score = 27.9 bits (59), Expect = 7.9 Identities = 23/58 (39%), Positives = 27/58 (46%), Gaps = 8/58 (13%) Frame = +1 Query: 157 RSNKLVIRQALLGPDAKPDELNVIQVEAMS-LQEAVKL-------PVAVLKVGESRHV 306 RS KL R + LGP KP L E+MS Q A +L PV V+ V E V Sbjct: 121 RSRKLRDRPSPLGPLGKPHSLTTTNEESMSKAQSATELLSLGSRPPVEVVSVEEGEEV 178 >At3g14000.2 68416.m01768 expressed protein Length = 374 Score = 27.9 bits (59), Expect = 7.9 Identities = 14/43 (32%), Positives = 21/43 (48%) Frame = -3 Query: 722 VAPSPAQFRYNYT*NGDGTTSPKWVSRRFVHFLAFFLGDAALP 594 VA + +FRY Y G G+++PK + + L FL P Sbjct: 81 VASNSGRFRYAYKRAGSGSSTPKILGKEMESRLKGFLSGEGTP 123 >At3g14000.1 68416.m01767 expressed protein Length = 374 Score = 27.9 bits (59), Expect = 7.9 Identities = 14/43 (32%), Positives = 21/43 (48%) Frame = -3 Query: 722 VAPSPAQFRYNYT*NGDGTTSPKWVSRRFVHFLAFFLGDAALP 594 VA + +FRY Y G G+++PK + + L FL P Sbjct: 81 VASNSGRFRYAYKRAGSGSSTPKILGKEMESRLKGFLSGEGTP 123 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,167,015 Number of Sequences: 28952 Number of extensions: 286036 Number of successful extensions: 727 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 710 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 727 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1721869952 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -