BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_F_B23 (728 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF291654-1|AAG00600.1| 1340|Anopheles gambiae thioester-containi... 26 1.4 AY500851-1|AAS77205.1| 605|Anopheles gambiae G-protein coupled ... 25 2.4 AF042732-3|AAC18058.1| 496|Anopheles gambiae diphenol oxidase-A... 25 2.4 DQ974164-1|ABJ52804.1| 410|Anopheles gambiae serpin 4C protein. 24 5.5 AJ549085-1|CAD70159.1| 529|Anopheles gambiae thioredoxin-disulf... 23 9.7 AJ549084-1|CAD70158.1| 505|Anopheles gambiae thioredoxin-disulf... 23 9.7 AJ459821-1|CAD30858.1| 502|Anopheles gambiae thioredoxin reduct... 23 9.7 >AF291654-1|AAG00600.1| 1340|Anopheles gambiae thioester-containing protein I protein. Length = 1340 Score = 25.8 bits (54), Expect = 1.4 Identities = 18/44 (40%), Positives = 27/44 (61%), Gaps = 4/44 (9%) Frame = +3 Query: 141 QVTVYD-VVAKQITDAIE--DIKYQLHTL-ENDGLLRGELKASE 260 Q T +D AK IT +E D+ ++ T +NDGL++ EL+ SE Sbjct: 350 QFTHHDGTPAKGITGKVEVSDVGFETTTTSDNDGLIKLELQPSE 393 >AY500851-1|AAS77205.1| 605|Anopheles gambiae G-protein coupled receptor 3 protein. Length = 605 Score = 25.0 bits (52), Expect = 2.4 Identities = 18/60 (30%), Positives = 22/60 (36%) Frame = +3 Query: 18 SCGTVASTVIMASKFKSEKIGIVGSGLIGRSWAMLFASVGYQVTVYDVVAKQITDAIEDI 197 S G+ S IG G S A SVG V V DV+ IT A+ + Sbjct: 126 SAGSSTQIAAFPLDHSSAAIGESADAAHGSSVAGGLGSVGSFVAVNDVIGMNITPALSQV 185 >AF042732-3|AAC18058.1| 496|Anopheles gambiae diphenol oxidase-A2 protein. Length = 496 Score = 25.0 bits (52), Expect = 2.4 Identities = 15/71 (21%), Positives = 33/71 (46%) Frame = +3 Query: 141 QVTVYDVVAKQITDAIEDIKYQLHTLENDGLLRGELKASEQFQCIKGSTDLATAVKGAVF 320 +++ D+ K D+ ED ++ + DG++ L + + K STD+ + + + Sbjct: 379 RISPQDIARKLGLDSPEDAEFIVAKAIRDGVIEATLDPEKGYMRTKESTDIYSTREPQLA 438 Query: 321 VQECVPENLDL 353 + + LDL Sbjct: 439 FHQRISFCLDL 449 >DQ974164-1|ABJ52804.1| 410|Anopheles gambiae serpin 4C protein. Length = 410 Score = 23.8 bits (49), Expect = 5.5 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = -1 Query: 710 NIRYINNFVVNETPNFIKDCV 648 ++RYIN++V N+T I D V Sbjct: 83 SVRYINSWVHNQTHGRIADIV 103 >AJ549085-1|CAD70159.1| 529|Anopheles gambiae thioredoxin-disulfide reductase protein. Length = 529 Score = 23.0 bits (47), Expect = 9.7 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +3 Query: 81 IVGSGLIGRSWAMLFASVGYQVTV 152 +VG+G IG A +GY V+V Sbjct: 222 LVGAGYIGLECAGFLKGLGYDVSV 245 >AJ549084-1|CAD70158.1| 505|Anopheles gambiae thioredoxin-disulfide reductase protein. Length = 505 Score = 23.0 bits (47), Expect = 9.7 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +3 Query: 81 IVGSGLIGRSWAMLFASVGYQVTV 152 +VG+G IG A +GY V+V Sbjct: 198 LVGAGYIGLECAGFLKGLGYDVSV 221 >AJ459821-1|CAD30858.1| 502|Anopheles gambiae thioredoxin reductase protein. Length = 502 Score = 23.0 bits (47), Expect = 9.7 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +3 Query: 81 IVGSGLIGRSWAMLFASVGYQVTV 152 +VG+G IG A +GY V+V Sbjct: 195 LVGAGYIGLECAGFLKGLGYDVSV 218 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 750,869 Number of Sequences: 2352 Number of extensions: 15100 Number of successful extensions: 22 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 74428737 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -