BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_F_B22 (543 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A7HJD5 Cluster: Putative uncharacterized protein; n=1; ... 32 9.8 UniRef50_Q74BJ6 Cluster: Valyl-tRNA synthetase; n=30; Bacteria|R... 32 9.8 >UniRef50_A7HJD5 Cluster: Putative uncharacterized protein; n=1; Fervidobacterium nodosum Rt17-B1|Rep: Putative uncharacterized protein - Fervidobacterium nodosum Rt17-B1 Length = 167 Score = 31.9 bits (69), Expect = 9.8 Identities = 14/31 (45%), Positives = 21/31 (67%) Frame = +2 Query: 359 LILFFCLALEILNLHGKVFFFFSDIKINYEV 451 LI F L++ + NL + FF SD+KIN+E+ Sbjct: 17 LIAMFLLSISLFNLK-RAFFVVSDLKINFEI 46 >UniRef50_Q74BJ6 Cluster: Valyl-tRNA synthetase; n=30; Bacteria|Rep: Valyl-tRNA synthetase - Geobacter sulfurreducens Length = 887 Score = 31.9 bits (69), Expect = 9.8 Identities = 16/41 (39%), Positives = 22/41 (53%) Frame = -2 Query: 395 SGFQAPGRKIKSVANHTFLYWNQINKIYHINIFGFMNLDVF 273 + F A GR IK Y N +NKI++ + F MNL+ F Sbjct: 555 AAFAAQGRDIKLAEERIAGYRNFVNKIWNASRFALMNLEGF 595 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 338,429,699 Number of Sequences: 1657284 Number of extensions: 5081947 Number of successful extensions: 14516 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 14146 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14513 length of database: 575,637,011 effective HSP length: 96 effective length of database: 416,537,747 effective search space used: 34989170748 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -