BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_F_B22 (543 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF222296-1|ABN79656.2| 403|Tribolium castaneum arginine vasopre... 24 0.75 AM292334-1|CAL23146.2| 390|Tribolium castaneum gustatory recept... 22 4.0 AM292333-1|CAL23145.2| 316|Tribolium castaneum gustatory recept... 22 4.0 >EF222296-1|ABN79656.2| 403|Tribolium castaneum arginine vasopressin receptor protein. Length = 403 Score = 24.2 bits (50), Expect = 0.75 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = +3 Query: 36 TKQTIKMFKYLIFVALLAFASAKPLLVSYTS 128 T + K+ YL +VA LAF + + +YTS Sbjct: 152 TSRRSKVMVYLAWVASLAFCIPQLTIFTYTS 182 >AM292334-1|CAL23146.2| 390|Tribolium castaneum gustatory receptor candidate 13 protein. Length = 390 Score = 21.8 bits (44), Expect = 4.0 Identities = 9/23 (39%), Positives = 15/23 (65%) Frame = -3 Query: 82 RATKIKYLNILIVCLVRRRVTDG 14 R+ +K LN+L +RR+ T+G Sbjct: 314 RSEVVKILNVLKKIALRRQTTNG 336 >AM292333-1|CAL23145.2| 316|Tribolium castaneum gustatory receptor candidate 12 protein. Length = 316 Score = 21.8 bits (44), Expect = 4.0 Identities = 9/23 (39%), Positives = 15/23 (65%) Frame = -3 Query: 82 RATKIKYLNILIVCLVRRRVTDG 14 R+ +K LN+L +RR+ T+G Sbjct: 240 RSEVVKILNVLKKIALRRQTTNG 262 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 83,765 Number of Sequences: 336 Number of extensions: 1369 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 13306679 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -