BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_F_B22 (543 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_26699| Best HMM Match : Peptidase_M13_N (HMM E-Value=0.8) 30 1.1 SB_1648| Best HMM Match : UPF0061 (HMM E-Value=5.2e-10) 28 5.7 SB_5276| Best HMM Match : DNA_RNApol_7kD (HMM E-Value=1.1) 27 7.5 >SB_26699| Best HMM Match : Peptidase_M13_N (HMM E-Value=0.8) Length = 306 Score = 30.3 bits (65), Expect = 1.1 Identities = 19/60 (31%), Positives = 28/60 (46%) Frame = +3 Query: 15 PSVTLRRTKQTIKMFKYLIFVALLAFASAKPLLVSYTSPDSCCIYCSGRCCVHRTPGVLC 194 P V + T+ + ++FV L A+ K S +SP S I C C+H + VLC Sbjct: 23 PQVKILAALSTLFLVIAIVFVGLFAYEKLKSAETSKSSPLSDKI-CFQPSCIHVSSVVLC 81 >SB_1648| Best HMM Match : UPF0061 (HMM E-Value=5.2e-10) Length = 371 Score = 27.9 bits (59), Expect = 5.7 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = +3 Query: 60 KYLIFVALLAFASAKPLLVSYTSPDSCC 143 KYLIF L+FAS K +L Y + + C Sbjct: 177 KYLIFPYFLSFASGKKILQRYAAEFNNC 204 >SB_5276| Best HMM Match : DNA_RNApol_7kD (HMM E-Value=1.1) Length = 886 Score = 27.5 bits (58), Expect = 7.5 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = -2 Query: 398 SSGFQAPGRKIKSVANHTFLYWNQIN 321 SSG+ + G + K V N L+WN N Sbjct: 743 SSGYASDGYRRKKVMNRNSLFWNNEN 768 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,240,169 Number of Sequences: 59808 Number of extensions: 155985 Number of successful extensions: 388 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 360 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 388 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1239956166 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -