BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_F_B22 (543 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BT024391-1|ABC86453.1| 144|Drosophila melanogaster IP05345p pro... 28 9.5 >BT024391-1|ABC86453.1| 144|Drosophila melanogaster IP05345p protein. Length = 144 Score = 27.9 bits (59), Expect = 9.5 Identities = 12/30 (40%), Positives = 20/30 (66%) Frame = +3 Query: 18 SVTLRRTKQTIKMFKYLIFVALLAFASAKP 107 S T + ++++ MFK ++ ALLA A A+P Sbjct: 4 STTQTKKQKSLNMFKLVVLSALLAVAVARP 33 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,932,366 Number of Sequences: 53049 Number of extensions: 229366 Number of successful extensions: 1067 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1033 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1067 length of database: 24,988,368 effective HSP length: 80 effective length of database: 20,744,448 effective search space used: 2074444800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -