BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_F_B19 (875 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_04_0089 - 22724971-22725035,22725403-22725466,22725602-227256... 29 4.9 >04_04_0089 - 22724971-22725035,22725403-22725466,22725602-22725688, 22726775-22726789,22736269-22736685,22738235-22738473, 22739673-22740223,22740440-22740540 Length = 512 Score = 29.1 bits (62), Expect = 4.9 Identities = 16/49 (32%), Positives = 24/49 (48%) Frame = -3 Query: 150 ILALIYLVDSSFVALVPISVRSLNANQQSLTIHRSCHC*LCSATPAIGR 4 +LAL YL + + L+ + V S+ A +S CHC S P + R Sbjct: 442 VLALHYLYKAPWATLILLFVTSIGA--KSCNKQHECHCHYLSYLPPVSR 488 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,326,435 Number of Sequences: 37544 Number of extensions: 339242 Number of successful extensions: 911 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 881 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 911 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2467979640 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -