BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_F_B14 (825 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g20640.1 68418.m02452 hypothetical protein contains Pfam prof... 28 6.5 At4g32375.1 68417.m04610 glycoside hydrolase family 28 protein /... 28 6.5 >At5g20640.1 68418.m02452 hypothetical protein contains Pfam profile PF04525: Protein of unknown function (DUF567) Length = 215 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +2 Query: 557 FRASGCSIFDTRSEKILLRGDKND 628 FR GC + T+ + +L GD ND Sbjct: 50 FRVDGCGVLGTKGKLLLRNGDGND 73 >At4g32375.1 68417.m04610 glycoside hydrolase family 28 protein / polygalacturonase (pectinase) family protein similar to polygalacturonase [Lycopersicon esculentum] GI:4325090; contains Pfam profile PF00295: Polygalacturonase (pectinase) Length = 486 Score = 28.3 bits (60), Expect = 6.5 Identities = 12/41 (29%), Positives = 24/41 (58%) Frame = +2 Query: 587 TRSEKILLRGDKNDSTGCKGIIHIHTDIMDNSKVQQVESHC 709 T + I ++ D ++ TGCK I+ H +I +S + + ++C Sbjct: 301 TCANDIAIKLDCDEVTGCKDIVMEHINITSSSTKRPLTAYC 341 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,935,844 Number of Sequences: 28952 Number of extensions: 268106 Number of successful extensions: 545 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 533 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 545 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1892353600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -