BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_F_B13 (821 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate r... 25 0.85 AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase pro... 24 1.5 DQ325115-1|ABD14129.1| 185|Apis mellifera complementary sex det... 23 2.6 AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 23 3.4 EF127805-1|ABL67942.1| 461|Apis mellifera nicotinic acetylcholi... 22 6.0 EF127804-1|ABL67941.1| 461|Apis mellifera nicotinic acetylcholi... 22 6.0 EF127803-1|ABL67940.1| 461|Apis mellifera nicotinic acetylcholi... 22 6.0 EF127802-1|ABL67939.1| 461|Apis mellifera nicotinic acetylcholi... 22 6.0 EF127801-1|ABL67938.1| 461|Apis mellifera nicotinic acetylcholi... 22 6.0 EF127800-1|ABL67937.1| 461|Apis mellifera nicotinic acetylcholi... 22 6.0 DQ026036-1|AAY87895.1| 529|Apis mellifera nicotinic acetylcholi... 22 6.0 DQ026035-1|AAY87894.1| 529|Apis mellifera nicotinic acetylcholi... 22 6.0 AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic ac... 22 6.0 AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-act... 22 7.9 AB083010-1|BAC54131.1| 132|Apis mellifera fatty acid binding pr... 22 7.9 >AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate receptor 1 protein. Length = 953 Score = 25.0 bits (52), Expect = 0.85 Identities = 13/42 (30%), Positives = 18/42 (42%) Frame = +3 Query: 138 PYILIRGNLASYGHKNPWRVLVSGLKAEDIEELKRFACGGYC 263 P++ +R +A P +L D E K F C GYC Sbjct: 423 PFVYVR-EIAFSESCLPEEILCPHFNVTDGETTKTFCCKGYC 463 >AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase protein. Length = 580 Score = 24.2 bits (50), Expect = 1.5 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = +3 Query: 702 EEIKALTKKYPGSGVVVNGVSI 767 +EI LT PG GVV NG I Sbjct: 368 DEIVMLTLTLPGIGVVYNGDEI 389 >DQ325115-1|ABD14129.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 23.4 bits (48), Expect = 2.6 Identities = 11/40 (27%), Positives = 21/40 (52%) Frame = +3 Query: 417 EPSIIVEQDNITNFSKEAMHLSNYHSNKDDEV*TLLYFKI 536 EP II ++++N + +NY++N + L Y+ I Sbjct: 78 EPKIISNNNSLSNNYNYNNNYNNYNNNYNTNYKKLQYYNI 117 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 23.0 bits (47), Expect = 3.4 Identities = 9/35 (25%), Positives = 17/35 (48%) Frame = -2 Query: 754 LTTTPDPGYFFVRAFISSSPSPNTELSFACKEPFI 650 +TT P P A I+++P +L+ +P + Sbjct: 824 ITTPPTPNLLRYFASIATNPKEQAQLNLLASDPAV 858 >EF127805-1|ABL67942.1| 461|Apis mellifera nicotinic acetylcholine receptor subunitalpha 6 transcript variant 6 protein. Length = 461 Score = 22.2 bits (45), Expect = 6.0 Identities = 7/19 (36%), Positives = 14/19 (73%) Frame = +3 Query: 294 PCVILSALEVLGYKVVASS 350 PCV++S++ +LG+ + S Sbjct: 204 PCVLISSMALLGFTLPPDS 222 >EF127804-1|ABL67941.1| 461|Apis mellifera nicotinic acetylcholine receptor subunitalpha 6 transcript variant 5 protein. Length = 461 Score = 22.2 bits (45), Expect = 6.0 Identities = 7/19 (36%), Positives = 14/19 (73%) Frame = +3 Query: 294 PCVILSALEVLGYKVVASS 350 PCV++S++ +LG+ + S Sbjct: 204 PCVLISSMALLGFTLPPDS 222 >EF127803-1|ABL67940.1| 461|Apis mellifera nicotinic acetylcholine receptor subunitalpha 6 transcript variant 4 protein. Length = 461 Score = 22.2 bits (45), Expect = 6.0 Identities = 7/19 (36%), Positives = 14/19 (73%) Frame = +3 Query: 294 PCVILSALEVLGYKVVASS 350 PCV++S++ +LG+ + S Sbjct: 204 PCVLISSMALLGFTLPPDS 222 >EF127802-1|ABL67939.1| 461|Apis mellifera nicotinic acetylcholine receptor subunitalpha 6 transcript variant 3 protein. Length = 461 Score = 22.2 bits (45), Expect = 6.0 Identities = 7/19 (36%), Positives = 14/19 (73%) Frame = +3 Query: 294 PCVILSALEVLGYKVVASS 350 PCV++S++ +LG+ + S Sbjct: 204 PCVLISSMALLGFTLPPDS 222 >EF127801-1|ABL67938.1| 461|Apis mellifera nicotinic acetylcholine receptor subunitalpha 6 transcript variant 2 protein. Length = 461 Score = 22.2 bits (45), Expect = 6.0 Identities = 7/19 (36%), Positives = 14/19 (73%) Frame = +3 Query: 294 PCVILSALEVLGYKVVASS 350 PCV++S++ +LG+ + S Sbjct: 204 PCVLISSMALLGFTLPPDS 222 >EF127800-1|ABL67937.1| 461|Apis mellifera nicotinic acetylcholine receptor subunitalpha 6 transcript variant 1 protein. Length = 461 Score = 22.2 bits (45), Expect = 6.0 Identities = 7/19 (36%), Positives = 14/19 (73%) Frame = +3 Query: 294 PCVILSALEVLGYKVVASS 350 PCV++S++ +LG+ + S Sbjct: 204 PCVLISSMALLGFTLPPDS 222 >DQ026036-1|AAY87895.1| 529|Apis mellifera nicotinic acetylcholine receptor alpha6subunit protein. Length = 529 Score = 22.2 bits (45), Expect = 6.0 Identities = 7/19 (36%), Positives = 14/19 (73%) Frame = +3 Query: 294 PCVILSALEVLGYKVVASS 350 PCV++S++ +LG+ + S Sbjct: 272 PCVLISSMALLGFTLPPDS 290 >DQ026035-1|AAY87894.1| 529|Apis mellifera nicotinic acetylcholine receptor alpha6subunit protein. Length = 529 Score = 22.2 bits (45), Expect = 6.0 Identities = 7/19 (36%), Positives = 14/19 (73%) Frame = +3 Query: 294 PCVILSALEVLGYKVVASS 350 PCV++S++ +LG+ + S Sbjct: 272 PCVLISSMALLGFTLPPDS 290 >AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic acetylcholine receptoralpha7-1 protein. Length = 555 Score = 22.2 bits (45), Expect = 6.0 Identities = 7/19 (36%), Positives = 14/19 (73%) Frame = +3 Query: 294 PCVILSALEVLGYKVVASS 350 PCV+++++ VLG+ + S Sbjct: 241 PCVLIASMAVLGFTLPPDS 259 >AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-activated ion channel protein. Length = 632 Score = 21.8 bits (44), Expect = 7.9 Identities = 8/30 (26%), Positives = 21/30 (70%) Frame = +2 Query: 29 IVPLVNLYFVNKLFI*TFIVQWKQIFFLSV 118 ++ LV L +++L ++ QW++++FL++ Sbjct: 213 LLSLVRLLRLSRLV--RYVSQWEEVYFLNM 240 >AB083010-1|BAC54131.1| 132|Apis mellifera fatty acid binding protein protein. Length = 132 Score = 21.8 bits (44), Expect = 7.9 Identities = 11/33 (33%), Positives = 16/33 (48%) Frame = +3 Query: 606 APIAPITEDGVVYIAIKGSLHANDSSVFGLGEE 704 +P+ +TE+ +Y S N F LGEE Sbjct: 38 SPVVELTENNGLYTLKTTSPFKNTEIKFKLGEE 70 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 199,549 Number of Sequences: 438 Number of extensions: 4256 Number of successful extensions: 19 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 26217432 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -