BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_F_B10 (605 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U50469-1|AAA93473.1| 160|Anopheles gambiae protein ( Anopheles ... 28 0.20 AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative different... 25 1.9 AB090815-1|BAC57905.1| 492|Anopheles gambiae gag-like protein p... 24 3.3 AY347946-1|AAR28374.1| 640|Anopheles gambiae putative NPY GPCR ... 23 7.7 >U50469-1|AAA93473.1| 160|Anopheles gambiae protein ( Anopheles gambiae putativecuticle protein mRNA, partial cds. ). Length = 160 Score = 28.3 bits (60), Expect = 0.20 Identities = 14/27 (51%), Positives = 16/27 (59%), Gaps = 1/27 (3%) Frame = +1 Query: 265 VQGSSGYTAPDGTPIQITYTADA-NGY 342 VQGS PDGT + YTAD NG+ Sbjct: 49 VQGSYSVVDPDGTKRTVDYTADPHNGF 75 >AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative differentiation regulator protein. Length = 1283 Score = 25.0 bits (52), Expect = 1.9 Identities = 13/35 (37%), Positives = 15/35 (42%) Frame = +3 Query: 165 PGQIPVPISDQQRNQWPGTRSARKRGP*GCIHRRP 269 PG +P P QQ+ G S G G IH P Sbjct: 120 PGLVPPPQQQQQQQAPLGIPSVAHGGGSGAIHASP 154 >AB090815-1|BAC57905.1| 492|Anopheles gambiae gag-like protein protein. Length = 492 Score = 24.2 bits (50), Expect = 3.3 Identities = 12/34 (35%), Positives = 15/34 (44%) Frame = +1 Query: 283 YTAPDGTPIQITYTADANGYQPSGAHLPTTPAPL 384 +T DG + T NG Q + LPT A L Sbjct: 360 FTELDGVTFETKMTKSFNGMQTASVKLPTKLATL 393 >AY347946-1|AAR28374.1| 640|Anopheles gambiae putative NPY GPCR protein. Length = 640 Score = 23.0 bits (47), Expect = 7.7 Identities = 9/25 (36%), Positives = 12/25 (48%) Frame = -1 Query: 251 SSRPSFTSTPCSWPLIPLLV*YWYW 177 SSR P SW L+P ++W Sbjct: 530 SSRSQLMKLPSSWDLLPYFWFAFHW 554 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 602,174 Number of Sequences: 2352 Number of extensions: 13287 Number of successful extensions: 21 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 58870980 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -