BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_F_B09 (516 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q17196 Cluster: Bombyxin B-11 precursor (BBX-B11) (4K-p... 120 3e-26 UniRef50_P26735 Cluster: Bombyxin C-2 precursor (BBX-C2) (4K-pro... 85 7e-16 UniRef50_O61271 Cluster: Bombyxin G-1 precursor (BBX-G1) [Contai... 83 5e-15 UniRef50_P21808 Cluster: Bombyxin E-1 precursor (BBX-E1) (Bombyx... 73 5e-12 UniRef50_O09209 Cluster: Bombyxin-related peptide A precursor (A... 64 2e-09 UniRef50_P91896 Cluster: Bombyxin F-1 precursor (BBX-F1) [Contai... 63 3e-09 UniRef50_A0EZS0 Cluster: Insulin-like peptide 6 splice variant A... 54 3e-06 UniRef50_Q91443 Cluster: Insulin-like growth factor II precursor... 52 6e-06 UniRef50_P33719 Cluster: Bombyxin A-2 homolog precursor [Contain... 51 1e-05 UniRef50_P01344 Cluster: Insulin-like growth factor II precursor... 50 2e-05 UniRef50_P22618 Cluster: Insulin-like growth factor precursor; n... 50 4e-05 UniRef50_Q90WW4 Cluster: Insulin-like growth factor II-A precurs... 46 4e-04 UniRef50_A0EZS2 Cluster: Insulin-like peptide 7; n=1; Aedes aegy... 45 9e-04 UniRef50_P05019 Cluster: Insulin-like growth factor IB precursor... 44 0.002 UniRef50_Q673F3 Cluster: Insulin-like growth factor 2; n=7; Mamm... 44 0.002 UniRef50_Q02816 Cluster: Insulin-like growth factor II precursor... 43 0.005 UniRef50_P22334 Cluster: Insulin-like peptide precursor [Contain... 42 0.011 UniRef50_Q90325 Cluster: Insulin-like growth factor I, adult for... 42 0.011 UniRef50_Q90WX8 Cluster: Insulin-like growth factor III precurso... 41 0.015 UniRef50_UPI00005464FF Cluster: PREDICTED: similar to insulin-li... 40 0.025 UniRef50_A0EZR7 Cluster: Insulin-like peptide 2; n=2; Aedes aegy... 40 0.025 UniRef50_P01308 Cluster: Insulin precursor [Contains: Insulin B ... 40 0.025 UniRef50_P13190 Cluster: Insulin [Contains: Insulin B chain; Ins... 37 0.026 UniRef50_UPI000156159C Cluster: PREDICTED: similar to insulin-li... 40 0.045 UniRef50_Q6VVH1 Cluster: Insulin-like peptide 1 precursor; n=5; ... 39 0.078 UniRef50_O76469 Cluster: Insulin-like peptide precursor; n=2; Ca... 39 0.078 UniRef50_Q2QAJ9 Cluster: Preproinsulin 2; n=1; Danio rerio|Rep: ... 38 0.10 UniRef50_Q499A6 Cluster: Zgc:110098; n=3; Danio rerio|Rep: Zgc:1... 38 0.14 UniRef50_UPI00015B5944 Cluster: PREDICTED: similar to LIRP precu... 37 0.24 UniRef50_P04667 Cluster: Insulin precursor [Contains: Insulin B ... 37 0.24 UniRef50_UPI0000DB7D6D Cluster: PREDICTED: similar to insulin-li... 37 0.31 UniRef50_O73727 Cluster: Insulin precursor [Contains: Insulin B ... 36 0.41 UniRef50_Q6VVG9 Cluster: Insulin-like peptide 3 precursor; n=4; ... 36 0.55 UniRef50_Q2LZ98 Cluster: GA20861-PA; n=1; Drosophila pseudoobscu... 36 0.55 UniRef50_P15131 Cluster: LIRP precursor (Locusta insulin-related... 36 0.55 UniRef50_A1XP48 Cluster: Insulin-like 0; n=1; Aplysia californic... 36 0.72 UniRef50_Q17MN7 Cluster: Putative uncharacterized protein; n=1; ... 35 0.96 UniRef50_Q6CQE3 Cluster: Kluyveromyces lactis strain NRRL Y-1140... 35 0.96 UniRef50_Q0GTF8 Cluster: Insulin-like 1 precursor; n=1; Ciona in... 34 1.7 UniRef50_Q9VT52 Cluster: Probable insulin-like peptide 3 precurs... 34 1.7 UniRef50_A5UWB1 Cluster: Putative uncharacterized protein; n=1; ... 33 2.9 UniRef50_Q6VVG8 Cluster: Insulin-like peptide 4 precursor; n=2; ... 33 2.9 UniRef50_P01342 Cluster: Insulin precursor [Contains: Insulin B ... 33 3.9 UniRef50_Q7KUD5 Cluster: Probable insulin-like peptide 5 precurs... 33 3.9 UniRef50_Q2LZ97 Cluster: GA12803-PA; n=1; Drosophila pseudoobscu... 33 5.1 UniRef50_Q0UPW1 Cluster: Putative uncharacterized protein; n=1; ... 33 5.1 UniRef50_A6G2G8 Cluster: Tyrosine protein kinase:Serine/threonin... 32 6.8 UniRef50_Q17623 Cluster: Putative uncharacterized protein; n=1; ... 32 6.8 UniRef50_UPI0000DB6D76 Cluster: PREDICTED: similar to genghis kh... 32 8.9 UniRef50_A4MHE5 Cluster: Putative uncharacterized protein; n=2; ... 32 8.9 UniRef50_Q4PH79 Cluster: Putative uncharacterized protein; n=1; ... 32 8.9 UniRef50_Q4P6I5 Cluster: Putative uncharacterized protein; n=1; ... 32 8.9 UniRef50_P67971 Cluster: Insulin [Contains: Insulin B chain; Ins... 32 8.9 UniRef50_P01315 Cluster: Insulin precursor [Contains: Insulin B ... 32 8.9 >UniRef50_Q17196 Cluster: Bombyxin B-11 precursor (BBX-B11) (4K-prothoracicotropic hormone) (4K- PTTH) [Contains: Bombyxin B-11 B chain; Bombyxin B-11 A chain]; n=12; Bombyx mori|Rep: Bombyxin B-11 precursor (BBX-B11) (4K-prothoracicotropic hormone) (4K- PTTH) [Contains: Bombyxin B-11 B chain; Bombyxin B-11 A chain] - Bombyx mori (Silk moth) Length = 93 Score = 120 bits (288), Expect = 3e-26 Identities = 54/81 (66%), Positives = 65/81 (80%) Frame = +2 Query: 83 FFVLIVLNLMWSGEAQEVARTYCGSHLADTLADLCFGVVKRGGAQYAPYFWQKAYLGSRG 262 F +++V++L +S E QEVARTYCG HLA+ LA +CFGV KRGGAQYAPY WQ+ YL SR Sbjct: 8 FILVVVISLTYSSEEQEVARTYCGRHLANILAYVCFGVEKRGGAQYAPY-WQETYLRSRK 66 Query: 263 KRGVVDECCFRPCTLDVLASY 325 GVVDECCFRPC L+VL S+ Sbjct: 67 GPGVVDECCFRPCKLEVLKSF 87 >UniRef50_P26735 Cluster: Bombyxin C-2 precursor (BBX-C2) (4K-prothoracicotropic hormone) (4K- PTTH) [Contains: Bombyxin C-2 B chain; Bombyxin C-2 A chain]; n=12; Bombyx mori|Rep: Bombyxin C-2 precursor (BBX-C2) (4K-prothoracicotropic hormone) (4K- PTTH) [Contains: Bombyxin C-2 B chain; Bombyxin C-2 A chain] - Bombyx mori (Silk moth) Length = 95 Score = 85.4 bits (202), Expect = 7e-16 Identities = 40/83 (48%), Positives = 55/83 (66%), Gaps = 3/83 (3%) Frame = +2 Query: 89 VLIVLNLMWSGEAQEVARTYCGSHLADTLADLCF-GVVKRGGAQYAPYFWQ--KAYLGSR 259 +++V ++ G AQ ++ YCG LA T++ LC+ + KR G+QYA Y W + SR Sbjct: 7 LVVVSAMLVLGGAQTASQFYCGDFLARTMSILCWPDMPKRSGSQYAGYGWPWLPPFSSSR 66 Query: 260 GKRGVVDECCFRPCTLDVLASYC 328 GKRG+VDECC+RPCT DVL YC Sbjct: 67 GKRGIVDECCYRPCTTDVLKLYC 89 >UniRef50_O61271 Cluster: Bombyxin G-1 precursor (BBX-G1) [Contains: Bombyxin G-1 B chain; Bombyxin G-1 A chain]; n=2; Bombyx mori|Rep: Bombyxin G-1 precursor (BBX-G1) [Contains: Bombyxin G-1 B chain; Bombyxin G-1 A chain] - Bombyx mori (Silk moth) Length = 90 Score = 82.6 bits (195), Expect = 5e-15 Identities = 44/85 (51%), Positives = 52/85 (61%), Gaps = 4/85 (4%) Frame = +2 Query: 86 FVLIVLNLMWSGEAQ-EVARTYCGSHLADTLADLCFGV-VKRGGAQYAPYFWQ-KAYLGS 256 FV+ + + S Q EVAR YCG HLA T+ADLCFGV + QY Y W AY Sbjct: 6 FVVFCITIYGSTSGQQEVARRYCGRHLAVTMADLCFGVQFDKRNTQYEGYHWPLLAYSEE 65 Query: 257 RGKR-GVVDECCFRPCTLDVLASYC 328 R KR G+ DECC PCT +VL+SYC Sbjct: 66 RIKRQGIADECCLVPCTTNVLSSYC 90 >UniRef50_P21808 Cluster: Bombyxin E-1 precursor (BBX-E1) (Bombyxin IV) (4K-prothoracicotropic hormone IV) (4K-PTTH-IV) [Contains: Bombyxin E-1 B chain; Bombyxin E-1 A chain]; n=1; Bombyx mori|Rep: Bombyxin E-1 precursor (BBX-E1) (Bombyxin IV) (4K-prothoracicotropic hormone IV) (4K-PTTH-IV) [Contains: Bombyxin E-1 B chain; Bombyxin E-1 A chain] - Bombyx mori (Silk moth) Length = 98 Score = 72.5 bits (170), Expect = 5e-12 Identities = 43/93 (46%), Positives = 53/93 (56%), Gaps = 11/93 (11%) Frame = +2 Query: 83 FFVLIVLNLMW-SGEAQEVARTYCGSHLADTLADLCF--GVVKRGGAQYAPYF-----WQ 238 F VL++ + + + VA YCG HLA+TLADLC+ V KR + A Y W Sbjct: 6 FLVLLLTGFLCIAAQEANVAHHYCGRHLANTLADLCWDTSVEKRSESSLASYSSRGWPWL 65 Query: 239 KA-YLGSRG--KRGVVDECCFRPCTLDVLASYC 328 R KRGVVDECC +PCTLDVLA+YC Sbjct: 66 PTPNFNKRAIKKRGVVDECCIQPCTLDVLATYC 98 >UniRef50_O09209 Cluster: Bombyxin-related peptide A precursor (ABRP) [Contains: Bombyxin- related peptide A chain B; Bombyxin-related peptide A chain A]; n=5; Obtectomera|Rep: Bombyxin-related peptide A precursor (ABRP) [Contains: Bombyxin- related peptide A chain B; Bombyxin-related peptide A chain A] - Agrius convolvuli (Morning glory sphinx moth) Length = 103 Score = 63.7 bits (148), Expect = 2e-09 Identities = 41/94 (43%), Positives = 51/94 (54%), Gaps = 12/94 (12%) Frame = +2 Query: 83 FFVLIVLNLMWSGEAQ-EVARTYCGSHLADTLADLCFGV-----VKRGGAQ----YAPYF 232 FF + L G+ + ++ CG HLA TLADLC V +KR GA+ Y Sbjct: 10 FFAVYSLAAAQGGQEEFQIKVRICGRHLARTLADLCPNVEYEDVMKRSGARSPALYGTVG 69 Query: 233 WQKAYLGS-RGKR-GVVDECCFRPCTLDVLASYC 328 W A G+ RGKR GV D+CC CT+DVL SYC Sbjct: 70 WPWARPGAARGKRAGVADDCCVNSCTMDVLLSYC 103 >UniRef50_P91896 Cluster: Bombyxin F-1 precursor (BBX-F1) [Contains: Bombyxin F-1 B chain; Bombyxin F-1 A chain]; n=2; Bombyx mori|Rep: Bombyxin F-1 precursor (BBX-F1) [Contains: Bombyxin F-1 B chain; Bombyxin F-1 A chain] - Bombyx mori (Silk moth) Length = 95 Score = 63.3 bits (147), Expect = 3e-09 Identities = 34/89 (38%), Positives = 54/89 (60%), Gaps = 9/89 (10%) Frame = +2 Query: 89 VLIVLNLMWSGEAQEV--ARTYCGSHLADTLADLCFGVVKRGGAQY-APYFWQKAYL--- 250 VL+V+++ AQE+ +R YCG HLA T+A LC+G+ + + + ++ + + Sbjct: 7 VLLVISVSILVSAQELGGSRRYCGRHLAQTMAVLCWGIDEMSAEKRNSDMVYEDSGMPEL 66 Query: 251 ---GSRGKRGVVDECCFRPCTLDVLASYC 328 +R KRG++DECC + CT DVL SYC Sbjct: 67 LPADTRKKRGIIDECCLQACTRDVLLSYC 95 >UniRef50_A0EZS0 Cluster: Insulin-like peptide 6 splice variant A; n=3; Aedes aegypti|Rep: Insulin-like peptide 6 splice variant A - Aedes aegypti (Yellowfever mosquito) Length = 157 Score = 53.6 bits (123), Expect = 3e-06 Identities = 28/79 (35%), Positives = 44/79 (55%) Frame = +2 Query: 92 LIVLNLMWSGEAQEVARTYCGSHLADTLADLCFGVVKRGGAQYAPYFWQKAYLGSRGKRG 271 L++L + + +A+ V ++ CG +LAD ++DLC RGG + R KRG Sbjct: 10 LLILLISKTVDARAVRKS-CGKYLADRISDLCKA---RGGYSQLTSVESERRSHRRSKRG 65 Query: 272 VVDECCFRPCTLDVLASYC 328 +V+ECC + CT +L YC Sbjct: 66 IVEECCHQSCTDTILMQYC 84 >UniRef50_Q91443 Cluster: Insulin-like growth factor II precursor; n=1; Squalus acanthias|Rep: Insulin-like growth factor II precursor - Squalus acanthias (Spiny dogfish) Length = 210 Score = 52.4 bits (120), Expect = 6e-06 Identities = 30/81 (37%), Positives = 40/81 (49%), Gaps = 1/81 (1%) Frame = +2 Query: 89 VLIVLNLMWSGEAQEVARTYCGSHLADTLADLCFGVVKRGGAQYAPYFWQKAY-LGSRGK 265 +L+ L + + T CGS L DTL +C A+ YF K SR Sbjct: 38 ILLALTVCIGTSEARLEETLCGSELVDTLQFIC--------AERGFYFVSKVVGRRSRQN 89 Query: 266 RGVVDECCFRPCTLDVLASYC 328 RG+V+ECCFR C L +L +YC Sbjct: 90 RGIVEECCFRSCDLLILETYC 110 >UniRef50_P33719 Cluster: Bombyxin A-2 homolog precursor [Contains: Bombyxin A-2 homolog B chain; Bombyxin A-2 homolog A chain]; n=3; Samia cynthia|Rep: Bombyxin A-2 homolog precursor [Contains: Bombyxin A-2 homolog B chain; Bombyxin A-2 homolog A chain] - Samia cynthia (Cynthia moth) (Ailanthus silkmoth) Length = 100 Score = 51.2 bits (117), Expect = 1e-05 Identities = 38/99 (38%), Positives = 53/99 (53%), Gaps = 13/99 (13%) Frame = +2 Query: 71 RLQ*FFVLIVLNLMWSGEAQEVARTYCGSHLADTLADLCFGV--VKRG---GAQYAPYFW 235 R Q F+++VL +M SG+ + A YCG LA L +C VKR ++ Y W Sbjct: 2 RTQVLFLIVVLAVMASGD--DTAHVYCGRRLATMLLYVCDNQYQVKRPPYISSENEGYGW 59 Query: 236 -----QKAYL--GSRGKR-GVVDECCFRPCTLDVLASYC 328 Q+A +RGKR G+V+ECC +PCT + L YC Sbjct: 60 KWLERQRARQLDEARGKRQGIVEECCNKPCTENELLGYC 98 >UniRef50_P01344 Cluster: Insulin-like growth factor II precursor (IGF-II) (Somatomedin-A) [Contains: Insulin-like growth factor II Ala-25 Del]; n=45; Eutheria|Rep: Insulin-like growth factor II precursor (IGF-II) (Somatomedin-A) [Contains: Insulin-like growth factor II Ala-25 Del] - Homo sapiens (Human) Length = 180 Score = 50.4 bits (115), Expect = 2e-05 Identities = 28/68 (41%), Positives = 36/68 (52%) Frame = +2 Query: 125 AQEVARTYCGSHLADTLADLCFGVVKRGGAQYAPYFWQKAYLGSRGKRGVVDECCFRPCT 304 A + T CG L DTL +C G + YF + A SR RG+V+ECCFR C Sbjct: 25 AYRPSETLCGGELVDTLQFVC------GDRGF--YFSRPASRVSRRSRGIVEECCFRSCD 76 Query: 305 LDVLASYC 328 L +L +YC Sbjct: 77 LALLETYC 84 >UniRef50_P22618 Cluster: Insulin-like growth factor precursor; n=13; Craniata|Rep: Insulin-like growth factor precursor - Myxine glutinosa (Atlantic hagfish) Length = 139 Score = 49.6 bits (113), Expect = 4e-05 Identities = 25/65 (38%), Positives = 38/65 (58%) Frame = +2 Query: 134 VARTYCGSHLADTLADLCFGVVKRGGAQYAPYFWQKAYLGSRGKRGVVDECCFRPCTLDV 313 ++ T CGS L DTL +C Q+ P + A+ SR ++G+V+ECCF+ C+L + Sbjct: 39 LSETLCGSELVDTLQFVCDDRGFFFVPQHVPPR-RGAHRRSRARKGIVEECCFKGCSLRL 97 Query: 314 LASYC 328 L YC Sbjct: 98 LEMYC 102 >UniRef50_Q90WW4 Cluster: Insulin-like growth factor II-A precursor; n=4; Xenopus|Rep: Insulin-like growth factor II-A precursor - Xenopus laevis (African clawed frog) Length = 217 Score = 46.4 bits (105), Expect = 4e-04 Identities = 24/71 (33%), Positives = 33/71 (46%) Frame = +2 Query: 116 SGEAQEVARTYCGSHLADTLADLCFGVVKRGGAQYAPYFWQKAYLGSRGKRGVVDECCFR 295 S +A T CG L DTL +C G + + R RG+VD CCF+ Sbjct: 53 SAKAYRATETLCGGELVDTLQFVC-------GDRGFYFSTNNGRSNRRPNRGIVDVCCFK 105 Query: 296 PCTLDVLASYC 328 C L++L +YC Sbjct: 106 SCDLELLETYC 116 >UniRef50_A0EZS2 Cluster: Insulin-like peptide 7; n=1; Aedes aegypti|Rep: Insulin-like peptide 7 - Aedes aegypti (Yellowfever mosquito) Length = 160 Score = 45.2 bits (102), Expect = 9e-04 Identities = 17/25 (68%), Positives = 22/25 (88%), Gaps = 1/25 (4%) Frame = +2 Query: 260 GKRGVVDECCFRPCTLD-VLASYCG 331 GKRGVVD+CC++PCTL +L +YCG Sbjct: 136 GKRGVVDDCCYKPCTLQYLLKNYCG 160 >UniRef50_P05019 Cluster: Insulin-like growth factor IB precursor; n=157; Gnathostomata|Rep: Insulin-like growth factor IB precursor - Homo sapiens (Human) Length = 195 Score = 44.4 bits (100), Expect = 0.002 Identities = 30/85 (35%), Positives = 39/85 (45%), Gaps = 4/85 (4%) Frame = +2 Query: 86 FVLIVLNLMWSGEAQEVARTYCGSHLADTLADLCFGVVKRGGAQYAPYFWQKAYLGSRGK 265 F L + L ++ A T CG+ L D L +C G + YF + GS + Sbjct: 33 FYLALCLLTFTSSATAGPETLCGAELVDALQFVC------GDRGF--YFNKPTGYGSSSR 84 Query: 266 R----GVVDECCFRPCTLDVLASYC 328 R G+VDECCFR C L L YC Sbjct: 85 RAPQTGIVDECCFRSCDLRRLEMYC 109 >UniRef50_Q673F3 Cluster: Insulin-like growth factor 2; n=7; Mammalia|Rep: Insulin-like growth factor 2 - Ornithorhynchus anatinus (Duckbill platypus) Length = 239 Score = 44.0 bits (99), Expect = 0.002 Identities = 24/65 (36%), Positives = 34/65 (52%), Gaps = 1/65 (1%) Frame = +2 Query: 137 ARTYCGSHLADTLADLCFGVVKRGGAQYAPYFWQK-AYLGSRGKRGVVDECCFRPCTLDV 313 + T CG L DTL +C G + YF + + R K+G+V+ECCF C L + Sbjct: 93 SETLCGGELVDTLQFVC------GDRGF--YFGRSPSRTNRRSKKGIVEECCFSSCDLAL 144 Query: 314 LASYC 328 L +YC Sbjct: 145 LETYC 149 >UniRef50_Q02816 Cluster: Insulin-like growth factor II precursor; n=73; Euteleostomi|Rep: Insulin-like growth factor II precursor - Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri) Length = 214 Score = 42.7 bits (96), Expect = 0.005 Identities = 24/64 (37%), Positives = 31/64 (48%) Frame = +2 Query: 137 ARTYCGSHLADTLADLCFGVVKRGGAQYAPYFWQKAYLGSRGKRGVVDECCFRPCTLDVL 316 A T CG L D L +C RG P ++ RG+V+ECCFR C L++L Sbjct: 52 AETLCGGELVDALQFVC---EDRGFYFSRPT--SRSNSRRSQNRGIVEECCFRSCDLNLL 106 Query: 317 ASYC 328 YC Sbjct: 107 EQYC 110 >UniRef50_P22334 Cluster: Insulin-like peptide precursor [Contains: Insulin-like peptide B chain; Insulin-like peptide A chain]; n=1; Branchiostoma californiense|Rep: Insulin-like peptide precursor [Contains: Insulin-like peptide B chain; Insulin-like peptide A chain] - Branchiostoma californiensis (California lancelet) (Amphioxus) Length = 305 Score = 41.5 bits (93), Expect = 0.011 Identities = 30/89 (33%), Positives = 40/89 (44%), Gaps = 13/89 (14%) Frame = +2 Query: 137 ARTYCGSHLADTLADLCFG---------VVKRGGAQYAPYFWQKAYLGS----RGKRGVV 277 A CGS LAD L+ +C V + + K Y+G+ R +RG+V Sbjct: 24 AEYLCGSTLADVLSFVCGNRGYNSQPRRSVSKRAIDFISEQQAKDYMGAMPHIRRRRGLV 83 Query: 278 DECCFRPCTLDVLASYCG*SIST*PANCT 364 +ECC+ C L SYC ST PA T Sbjct: 84 EECCYNVCDYSQLESYCN-PYSTAPATAT 111 >UniRef50_Q90325 Cluster: Insulin-like growth factor I, adult form precursor; n=27; Clupeocephala|Rep: Insulin-like growth factor I, adult form precursor - Cyprinus carpio (Common carp) Length = 161 Score = 41.5 bits (93), Expect = 0.011 Identities = 25/62 (40%), Positives = 31/62 (50%) Frame = +2 Query: 143 TYCGSHLADTLADLCFGVVKRGGAQYAPYFWQKAYLGSRGKRGVVDECCFRPCTLDVLAS 322 T CG+ L DTL +C RG P + + S RG+VDECCF+ C L L Sbjct: 48 TLCGAELVDTLQFVCGD---RGFYFSKPTGYGPSSRRSHN-RGIVDECCFQSCELRRLEM 103 Query: 323 YC 328 YC Sbjct: 104 YC 105 >UniRef50_Q90WX8 Cluster: Insulin-like growth factor III precursor; n=2; Xenopus|Rep: Insulin-like growth factor III precursor - Xenopus laevis (African clawed frog) Length = 127 Score = 41.1 bits (92), Expect = 0.015 Identities = 22/60 (36%), Positives = 32/60 (53%) Frame = +2 Query: 149 CGSHLADTLADLCFGVVKRGGAQYAPYFWQKAYLGSRGKRGVVDECCFRPCTLDVLASYC 328 CGS L D L +C G + Y + A +R + G+V+ECCF C++ +L SYC Sbjct: 61 CGSELVDILQFIC------GPTGF--YVSKGASFRNRNRPGIVEECCFCGCSVAILESYC 112 >UniRef50_UPI00005464FF Cluster: PREDICTED: similar to insulin-like growth factor-I; n=2; Danio rerio|Rep: PREDICTED: similar to insulin-like growth factor-I - Danio rerio Length = 188 Score = 40.3 bits (90), Expect = 0.025 Identities = 27/66 (40%), Positives = 31/66 (46%) Frame = +2 Query: 131 EVARTYCGSHLADTLADLCFGVVKRGGAQYAPYFWQKAYLGSRGKRGVVDECCFRPCTLD 310 E AR CG L D L +C RG P + SRGK G+VD+CC R C L Sbjct: 42 EGARARCGRELVDDLEFVCGD---RGFYIGKPGAARSGGPRSRGK-GIVDQCCVRGCDLQ 97 Query: 311 VLASYC 328 L YC Sbjct: 98 HLELYC 103 >UniRef50_A0EZR7 Cluster: Insulin-like peptide 2; n=2; Aedes aegypti|Rep: Insulin-like peptide 2 - Aedes aegypti (Yellowfever mosquito) Length = 167 Score = 40.3 bits (90), Expect = 0.025 Identities = 13/24 (54%), Positives = 18/24 (75%) Frame = +2 Query: 257 RGKRGVVDECCFRPCTLDVLASYC 328 + RG+VDECC RPC+++ L YC Sbjct: 140 KSPRGIVDECCLRPCSINQLLKYC 163 >UniRef50_P01308 Cluster: Insulin precursor [Contains: Insulin B chain; Insulin A chain]; n=85; Gnathostomata|Rep: Insulin precursor [Contains: Insulin B chain; Insulin A chain] - Homo sapiens (Human) Length = 110 Score = 40.3 bits (90), Expect = 0.025 Identities = 21/50 (42%), Positives = 27/50 (54%) Frame = +2 Query: 179 DLCFGVVKRGGAQYAPYFWQKAYLGSRGKRGVVDECCFRPCTLDVLASYC 328 DL G V+ GG A A GS KRG+V++CC C+L L +YC Sbjct: 60 DLQVGQVELGGGPGAGSLQPLALEGSLQKRGIVEQCCTSICSLYQLENYC 109 >UniRef50_P13190 Cluster: Insulin [Contains: Insulin B chain; Insulin A chain]; n=3; Gnathostomata|Rep: Insulin [Contains: Insulin B chain; Insulin A chain] - Callorhynchus milii (Elephant shark) (Elephantfish) Length = 89 Score = 37.1 bits (82), Expect(2) = 0.026 Identities = 17/35 (48%), Positives = 22/35 (62%) Frame = +2 Query: 224 PYFWQKAYLGSRGKRGVVDECCFRPCTLDVLASYC 328 PY Q A GS+ KRG+V++CC C+L L YC Sbjct: 56 PYRQQLA--GSKMKRGIVEQCCHNTCSLVNLEGYC 88 Score = 22.6 bits (46), Expect(2) = 0.026 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = +2 Query: 149 CGSHLADTLADLC 187 CGSHL D L +C Sbjct: 7 CGSHLVDALYFVC 19 >UniRef50_UPI000156159C Cluster: PREDICTED: similar to insulin-like growth factor 2; n=1; Equus caballus|Rep: PREDICTED: similar to insulin-like growth factor 2 - Equus caballus Length = 199 Score = 39.5 bits (88), Expect = 0.045 Identities = 14/25 (56%), Positives = 19/25 (76%) Frame = +2 Query: 254 SRGKRGVVDECCFRPCTLDVLASYC 328 +R RG+V+ECCFR C L +L +YC Sbjct: 78 NRRSRGIVEECCFRSCDLALLETYC 102 >UniRef50_Q6VVH1 Cluster: Insulin-like peptide 1 precursor; n=5; Anopheles gambiae|Rep: Insulin-like peptide 1 precursor - Anopheles gambiae (African malaria mosquito) Length = 154 Score = 38.7 bits (86), Expect = 0.078 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = +2 Query: 257 RGKRGVVDECCFRPCTLDVLASYC 328 R +R VV ECC++ CTLD L SYC Sbjct: 129 RVRRQVVAECCYQSCTLDTLKSYC 152 >UniRef50_O76469 Cluster: Insulin-like peptide precursor; n=2; Caenorhabditis|Rep: Insulin-like peptide precursor - Caenorhabditis elegans Length = 109 Score = 38.7 bits (86), Expect = 0.078 Identities = 28/91 (30%), Positives = 42/91 (46%), Gaps = 9/91 (9%) Frame = +2 Query: 83 FFVLIVLNLMWSGEAQEVARTYCGSHLADTLA-----DLCFGVV--KRGGAQ-YAPYFWQ 238 FF + + L+ S + + CGS L TL LC G+ KR Q YAP Sbjct: 13 FFGFLAILLLSSPTPSDASIRLCGSRLTTTLLAVCRNQLCTGLTAFKRSADQSYAPTTRD 72 Query: 239 KAYLGSRGKRG-VVDECCFRPCTLDVLASYC 328 ++ + KRG + ECC + C+ L ++C Sbjct: 73 LFHIHHQQKRGGIATECCEKRCSFAYLKTFC 103 >UniRef50_Q2QAJ9 Cluster: Preproinsulin 2; n=1; Danio rerio|Rep: Preproinsulin 2 - Danio rerio (Zebrafish) (Brachydanio rerio) Length = 107 Score = 38.3 bits (85), Expect = 0.10 Identities = 13/22 (59%), Positives = 17/22 (77%) Frame = +2 Query: 263 KRGVVDECCFRPCTLDVLASYC 328 KRG+V++CC RPCT+ L YC Sbjct: 85 KRGIVEQCCHRPCTIYHLEDYC 106 >UniRef50_Q499A6 Cluster: Zgc:110098; n=3; Danio rerio|Rep: Zgc:110098 - Danio rerio (Zebrafish) (Brachydanio rerio) Length = 288 Score = 37.9 bits (84), Expect = 0.14 Identities = 19/54 (35%), Positives = 27/54 (50%), Gaps = 1/54 (1%) Frame = -2 Query: 263 SREIPSMLSARSRARTEHHRVSPLRSTSRRVYPPSEIRNTYALPPG-PHLTTSG 105 SR + + + A + R PL S+SRR +PPS + Y PP PH +G Sbjct: 114 SRALSTYMEAEGKKRASDPSTDPLSSSSRRSFPPSFWDSNYPSPPSRPHCDPTG 167 >UniRef50_UPI00015B5944 Cluster: PREDICTED: similar to LIRP precursor (Locusta insulin-related peptide); n=1; Nasonia vitripennis|Rep: PREDICTED: similar to LIRP precursor (Locusta insulin-related peptide) - Nasonia vitripennis Length = 136 Score = 37.1 bits (82), Expect = 0.24 Identities = 13/24 (54%), Positives = 17/24 (70%) Frame = +2 Query: 257 RGKRGVVDECCFRPCTLDVLASYC 328 R RGV DECC + CT++ + SYC Sbjct: 109 RDSRGVHDECCLKSCTMNEMRSYC 132 >UniRef50_P04667 Cluster: Insulin precursor [Contains: Insulin B chain; Insulin A chain]; n=8; Elopocephala|Rep: Insulin precursor [Contains: Insulin B chain; Insulin A chain] - Oncorhynchus keta (Chum salmon) Length = 105 Score = 37.1 bits (82), Expect = 0.24 Identities = 27/95 (28%), Positives = 40/95 (42%), Gaps = 16/95 (16%) Frame = +2 Query: 92 LIVLNLMWSGEAQEVARTYCGSHLADTLADLC----------------FGVVKRGGAQYA 223 L+VL + G A+ CGSHL D L +C G + A+ Sbjct: 10 LLVLLALSPGVDAAAAQHLCGSHLVDALYLVCGEKGFFYTPKRDVDPLIGFLSPKSAKEN 69 Query: 224 PYFWQKAYLGSRGKRGVVDECCFRPCTLDVLASYC 328 + K KRG+V++CC +PC + L +YC Sbjct: 70 EEYPFKDQTEMMVKRGIVEQCCHKPCNIFDLQNYC 104 >UniRef50_UPI0000DB7D6D Cluster: PREDICTED: similar to insulin-like peptide 3 CG14167-PA; n=1; Apis mellifera|Rep: PREDICTED: similar to insulin-like peptide 3 CG14167-PA - Apis mellifera Length = 73 Score = 36.7 bits (81), Expect = 0.31 Identities = 12/25 (48%), Positives = 17/25 (68%) Frame = +2 Query: 257 RGKRGVVDECCFRPCTLDVLASYCG 331 R +G+ +ECC + CT + L SYCG Sbjct: 47 RNSKGIHEECCLKSCTTEELRSYCG 71 >UniRef50_O73727 Cluster: Insulin precursor [Contains: Insulin B chain; Insulin A chain]; n=19; Teleostei|Rep: Insulin precursor [Contains: Insulin B chain; Insulin A chain] - Danio rerio (Zebrafish) (Brachydanio rerio) Length = 108 Score = 36.3 bits (80), Expect = 0.41 Identities = 11/22 (50%), Positives = 18/22 (81%) Frame = +2 Query: 263 KRGVVDECCFRPCTLDVLASYC 328 KRG+V++CC +PC++ L +YC Sbjct: 86 KRGIVEQCCHKPCSIFELQNYC 107 >UniRef50_Q6VVG9 Cluster: Insulin-like peptide 3 precursor; n=4; Anopheles gambiae|Rep: Insulin-like peptide 3 precursor - Anopheles gambiae (African malaria mosquito) Length = 160 Score = 35.9 bits (79), Expect = 0.55 Identities = 11/24 (45%), Positives = 17/24 (70%) Frame = +2 Query: 257 RGKRGVVDECCFRPCTLDVLASYC 328 + + G+V+ECC RPC ++ L YC Sbjct: 131 KNRGGIVEECCLRPCGMNQLLQYC 154 >UniRef50_Q2LZ98 Cluster: GA20861-PA; n=1; Drosophila pseudoobscura|Rep: GA20861-PA - Drosophila pseudoobscura (Fruit fly) Length = 103 Score = 35.9 bits (79), Expect = 0.55 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = +2 Query: 257 RGKRGVVDECCFRPCTLDVLASYC 328 R ++G+ D CC +PC + VL YC Sbjct: 78 RTRQGIADRCCRKPCDISVLTEYC 101 >UniRef50_P15131 Cluster: LIRP precursor (Locusta insulin-related peptide) [Contains: LIRP B chain; 5 kDa peptide (C chain); LIRP A chain]; n=1; Locusta migratoria|Rep: LIRP precursor (Locusta insulin-related peptide) [Contains: LIRP B chain; 5 kDa peptide (C chain); LIRP A chain] - Locusta migratoria (Migratory locust) Length = 145 Score = 35.9 bits (79), Expect = 0.55 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = +2 Query: 257 RGKRGVVDECCFRPCTLDVLASYCG 331 R RGV DECC + C++ L +YCG Sbjct: 119 RRTRGVFDECCRKSCSISELQTYCG 143 >UniRef50_A1XP48 Cluster: Insulin-like 0; n=1; Aplysia californica|Rep: Insulin-like 0 - Aplysia californica (California sea hare) Length = 262 Score = 35.5 bits (78), Expect = 0.72 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +2 Query: 272 VVDECCFRPCTLDVLASYC 328 +VDECC RPC L SYC Sbjct: 171 IVDECCLRPCNFATLQSYC 189 >UniRef50_Q17MN7 Cluster: Putative uncharacterized protein; n=1; Aedes aegypti|Rep: Putative uncharacterized protein - Aedes aegypti (Yellowfever mosquito) Length = 174 Score = 35.1 bits (77), Expect = 0.96 Identities = 13/24 (54%), Positives = 16/24 (66%) Frame = +2 Query: 257 RGKRGVVDECCFRPCTLDVLASYC 328 R +R +VDECC + CTL L YC Sbjct: 149 RVRRQIVDECCRKSCTLKTLKQYC 172 >UniRef50_Q6CQE3 Cluster: Kluyveromyces lactis strain NRRL Y-1140 chromosome D of strain NRRL Y- 1140 of Kluyveromyces lactis; n=3; Eukaryota|Rep: Kluyveromyces lactis strain NRRL Y-1140 chromosome D of strain NRRL Y- 1140 of Kluyveromyces lactis - Kluyveromyces lactis (Yeast) (Candida sphaerica) Length = 119 Score = 35.1 bits (77), Expect = 0.96 Identities = 21/52 (40%), Positives = 33/52 (63%) Frame = -2 Query: 284 IRPLRRVSREIPSMLSARSRARTEHHRVSPLRSTSRRVYPPSEIRNTYALPP 129 I PLRRV+R++P+ L +R R+R+ L SR++ PP+ +N +A PP Sbjct: 59 IVPLRRVNRQVPATLFSRLRSRS-------LSQLSRQITPPT--KNGHAPPP 101 >UniRef50_Q0GTF8 Cluster: Insulin-like 1 precursor; n=1; Ciona intestinalis|Rep: Insulin-like 1 precursor - Ciona intestinalis (Transparent sea squirt) Length = 275 Score = 34.3 bits (75), Expect = 1.7 Identities = 20/67 (29%), Positives = 31/67 (46%), Gaps = 2/67 (2%) Frame = +2 Query: 137 ARTYCGSHLADTLADLCF--GVVKRGGAQYAPYFWQKAYLGSRGKRGVVDECCFRPCTLD 310 A CGS L D L +C G+ G Y + + ++L R + + CC R CT+ Sbjct: 67 AEYLCGSRLVDALRFICGSRGINGPGRGSYM-HARRGSHLRKRPEADITVLCCERGCTMK 125 Query: 311 VLASYCG 331 + +CG Sbjct: 126 QMERFCG 132 >UniRef50_Q9VT52 Cluster: Probable insulin-like peptide 3 precursor (Insulin-related peptide) (DILP3) [Contains: Probable insulin-like peptide 3 A chain; Probable insulin-like peptide 3 B chain]; n=3; Drosophila melanogaster|Rep: Probable insulin-like peptide 3 precursor (Insulin-related peptide) (DILP3) [Contains: Probable insulin-like peptide 3 A chain; Probable insulin-like peptide 3 B chain] - Drosophila melanogaster (Fruit fly) Length = 120 Score = 34.3 bits (75), Expect = 1.7 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = +2 Query: 257 RGKRGVVDECCFRPCTLDVLASYC 328 R + GV DECC + CT+D + YC Sbjct: 91 RLRDGVFDECCLKSCTMDEVLRYC 114 >UniRef50_A5UWB1 Cluster: Putative uncharacterized protein; n=1; Roseiflexus sp. RS-1|Rep: Putative uncharacterized protein - Roseiflexus sp. RS-1 Length = 1243 Score = 33.5 bits (73), Expect = 2.9 Identities = 19/60 (31%), Positives = 30/60 (50%) Frame = -3 Query: 274 YAAFPARSQVCFLPEVGRVLSTTAFHHSEAQVGECIRQVRSAIRTRYLLGLT*PHQVEHD 95 +A FP P++ RVL+ AF H+ AQ+G + R + +GLT + + HD Sbjct: 1112 FATFPFPPAEDAAPDLARVLAHPAFAHA-AQIGAAYHERRREVMQARRIGLTKTYNLLHD 1170 >UniRef50_Q6VVG8 Cluster: Insulin-like peptide 4 precursor; n=2; Anopheles gambiae|Rep: Insulin-like peptide 4 precursor - Anopheles gambiae (African malaria mosquito) Length = 160 Score = 33.5 bits (73), Expect = 2.9 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = +2 Query: 245 YLGSRGKRGVVDECCFRPCTLDVLASYC 328 +L +R +R V DECC C++ L SYC Sbjct: 123 HLKTRFRRDVADECCREDCSMAQLLSYC 150 >UniRef50_P01342 Cluster: Insulin precursor [Contains: Insulin B chain; Insulin A chain]; n=1; Myxine glutinosa|Rep: Insulin precursor [Contains: Insulin B chain; Insulin A chain] - Myxine glutinosa (Atlantic hagfish) Length = 115 Score = 33.1 bits (72), Expect = 3.9 Identities = 10/24 (41%), Positives = 18/24 (75%) Frame = +2 Query: 257 RGKRGVVDECCFRPCTLDVLASYC 328 + KRG+V++CC + C++ L +YC Sbjct: 91 KSKRGIVEQCCHKRCSIYDLENYC 114 >UniRef50_Q7KUD5 Cluster: Probable insulin-like peptide 5 precursor (Insulin-related peptide) (DILP5) [Contains: Probable insulin-like peptide 5 A chain; Probable insulin-like peptide 5 B chain]; n=2; Drosophila melanogaster|Rep: Probable insulin-like peptide 5 precursor (Insulin-related peptide) (DILP5) [Contains: Probable insulin-like peptide 5 A chain; Probable insulin-like peptide 5 B chain] - Drosophila melanogaster (Fruit fly) Length = 108 Score = 33.1 bits (72), Expect = 3.9 Identities = 12/24 (50%), Positives = 15/24 (62%) Frame = +2 Query: 257 RGKRGVVDECCFRPCTLDVLASYC 328 R RGVVD CC + C+ L +YC Sbjct: 83 RDFRGVVDSCCRKSCSFSTLRAYC 106 >UniRef50_Q2LZ97 Cluster: GA12803-PA; n=1; Drosophila pseudoobscura|Rep: GA12803-PA - Drosophila pseudoobscura (Fruit fly) Length = 102 Score = 32.7 bits (71), Expect = 5.1 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +2 Query: 257 RGKRGVVDECCFRPCTLDVLASYC 328 R G+ DECC C + LASYC Sbjct: 76 RSSGGIYDECCVYSCRYEELASYC 99 >UniRef50_Q0UPW1 Cluster: Putative uncharacterized protein; n=1; Phaeosphaeria nodorum|Rep: Putative uncharacterized protein - Phaeosphaeria nodorum (Septoria nodorum) Length = 619 Score = 32.7 bits (71), Expect = 5.1 Identities = 14/34 (41%), Positives = 17/34 (50%) Frame = -1 Query: 339 ILYPQYDARTSSVQGRKQHSSTTPRFPRDPKYAF 238 +L P + R SS QHS T P+ D KY F Sbjct: 291 VLKPAHSRRVSSTSAYSQHSQTLPQGQEDKKYTF 324 >UniRef50_A6G2G8 Cluster: Tyrosine protein kinase:Serine/threonine protein kinase; n=1; Plesiocystis pacifica SIR-1|Rep: Tyrosine protein kinase:Serine/threonine protein kinase - Plesiocystis pacifica SIR-1 Length = 1266 Score = 32.3 bits (70), Expect = 6.8 Identities = 21/68 (30%), Positives = 29/68 (42%) Frame = +2 Query: 113 WSGEAQEVARTYCGSHLADTLADLCFGVVKRGGAQYAPYFWQKAYLGSRGKRGVVDECCF 292 WSG+ +V T + +T+ D G +Q A W+ L S RG+ D CC Sbjct: 100 WSGDPVDVLSTL---GMGETIPDPRQAKAGAGASQAAAGQWRGTALSSERIRGLADICCD 156 Query: 293 RPCTLDVL 316 LD L Sbjct: 157 LVSALDAL 164 >UniRef50_Q17623 Cluster: Putative uncharacterized protein; n=1; Caenorhabditis elegans|Rep: Putative uncharacterized protein - Caenorhabditis elegans Length = 236 Score = 32.3 bits (70), Expect = 6.8 Identities = 18/58 (31%), Positives = 34/58 (58%) Frame = -2 Query: 284 IRPLRRVSREIPSMLSARSRARTEHHRVSPLRSTSRRVYPPSEIRNTYALPPGPHLTT 111 +R + ++ + S+++ R A+ + R S L +TS+R++ E +Y LPP H+TT Sbjct: 14 VRSIENMAGTLHSLVALRLFAKDMNTR-SQLVATSQRLHKELEPDKSYPLPPLSHITT 70 >UniRef50_UPI0000DB6D76 Cluster: PREDICTED: similar to genghis khan CG4012-PA; n=1; Apis mellifera|Rep: PREDICTED: similar to genghis khan CG4012-PA - Apis mellifera Length = 1741 Score = 31.9 bits (69), Expect = 8.9 Identities = 21/72 (29%), Positives = 34/72 (47%) Frame = -2 Query: 293 GNSIRPLRRVSREIPSMLSARSRARTEHHRVSPLRSTSRRVYPPSEIRNTYALPPGPHLT 114 GN I+ R + ++P+ L + T HH S L S+ +R+Y P+ ++ P P Sbjct: 1573 GNGIQIQRLL--DLPTTLETADQQHTGHHSSSHLHSSQQRLYSPAIQTSSKPAPLPPRHP 1630 Query: 113 TSG*ARLIQKIT 78 S RL I+ Sbjct: 1631 PSDTRRLSSHIS 1642 >UniRef50_A4MHE5 Cluster: Putative uncharacterized protein; n=2; Burkholderia pseudomallei|Rep: Putative uncharacterized protein - Burkholderia pseudomallei 305 Length = 350 Score = 31.9 bits (69), Expect = 8.9 Identities = 18/56 (32%), Positives = 29/56 (51%) Frame = -2 Query: 332 IRSTMRERQVCKAGNSIRPLRRVSREIPSMLSARSRARTEHHRVSPLRSTSRRVYP 165 + S + C A +++ + S S L++ + ART HRV+P RS S R+ P Sbjct: 218 VASRIAASTACVAPSALASAAQASTS--SSLASGAAARTASHRVAPYRSVSLRIAP 271 >UniRef50_Q4PH79 Cluster: Putative uncharacterized protein; n=1; Ustilago maydis|Rep: Putative uncharacterized protein - Ustilago maydis (Smut fungus) Length = 707 Score = 31.9 bits (69), Expect = 8.9 Identities = 19/48 (39%), Positives = 24/48 (50%), Gaps = 2/48 (4%) Frame = +3 Query: 180 TCASEW*NAVVLSTRPTS--GRKHTWDLAGNAA*WTNAVSGLAHLTFS 317 TCA V LS+ PT+ K TWD + A WT V+ L H+ S Sbjct: 18 TCALAAPLQVTLSSNPTTCQSTKITWDTSTGTAPWTVTVAPLGHVPVS 65 >UniRef50_Q4P6I5 Cluster: Putative uncharacterized protein; n=1; Ustilago maydis|Rep: Putative uncharacterized protein - Ustilago maydis (Smut fungus) Length = 1734 Score = 31.9 bits (69), Expect = 8.9 Identities = 21/66 (31%), Positives = 32/66 (48%), Gaps = 1/66 (1%) Frame = -2 Query: 302 CKAGNSIRPLRRVSREIPSM-LSARSRARTEHHRVSPLRSTSRRVYPPSEIRNTYALPPG 126 C + +S R + +PS +SA + + H VSP+ + R YPPS +PP Sbjct: 96 CDSNSSTNVDRAFAFAVPSHPVSAETAPPSAEHGVSPVINAFRSPYPPSPTYFVTVVPP- 154 Query: 125 PHLTTS 108 HL+ S Sbjct: 155 DHLSIS 160 >UniRef50_P67971 Cluster: Insulin [Contains: Insulin B chain; Insulin A chain]; n=7; Euteleostomi|Rep: Insulin [Contains: Insulin B chain; Insulin A chain] - Saimiri sciureus (Common squirrel monkey) Length = 51 Score = 31.9 bits (69), Expect = 8.9 Identities = 18/42 (42%), Positives = 23/42 (54%), Gaps = 7/42 (16%) Frame = +2 Query: 224 PYFWQKAYL--GSRG-----KRGVVDECCFRPCTLDVLASYC 328 P+ + YL G RG K GVVD+CC C+L L +YC Sbjct: 9 PHLVEALYLVCGERGFFYAPKTGVVDQCCTSICSLYQLQNYC 50 >UniRef50_P01315 Cluster: Insulin precursor [Contains: Insulin B chain; Insulin A chain]; n=12; Eukaryota|Rep: Insulin precursor [Contains: Insulin B chain; Insulin A chain] - Sus scrofa (Pig) Length = 108 Score = 31.9 bits (69), Expect = 8.9 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +2 Query: 251 GSRGKRGVVDECCFRPCTLDVLASYC 328 G KRG+V++CC C+L L +YC Sbjct: 82 GPPQKRGIVEQCCTSICSLYQLENYC 107 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 396,830,931 Number of Sequences: 1657284 Number of extensions: 7946167 Number of successful extensions: 23710 Number of sequences better than 10.0: 54 Number of HSP's better than 10.0 without gapping: 23096 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23675 length of database: 575,637,011 effective HSP length: 95 effective length of database: 418,195,031 effective search space used: 31782822356 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -