BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_F_B09 (516 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellif... 24 1.1 AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex det... 23 1.9 AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex det... 23 1.9 DQ325124-1|ABD14138.1| 179|Apis mellifera complementary sex det... 22 4.3 DQ325123-1|ABD14137.1| 179|Apis mellifera complementary sex det... 22 4.3 DQ325122-1|ABD14136.1| 179|Apis mellifera complementary sex det... 22 4.3 AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisp... 22 4.3 AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. 21 7.5 AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor typ... 21 7.5 EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage prot... 21 10.0 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 21 10.0 AB022907-1|BAA86908.1| 615|Apis mellifera glucose oxidase protein. 21 10.0 >AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellifera ORF for hypotheticalprotein. ). Length = 998 Score = 23.8 bits (49), Expect = 1.1 Identities = 12/31 (38%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +1 Query: 202 TRWC-SVRALLLAESILGISRETRRSGRMLF 291 +++C SV L +A S++ +SR +S RML+ Sbjct: 703 SKFCLSVTLLTVATSLVIVSRYAEKSRRMLY 733 >AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 23.0 bits (47), Expect = 1.9 Identities = 21/67 (31%), Positives = 25/67 (37%) Frame = -2 Query: 341 KYSIRSTMRERQVCKAGNSIRPLRRVSREIPSMLSARSRARTEHHRVSPLRSTSRRVYPP 162 +YS RS RE+ K R R S+ RSR RTE R + S Y Sbjct: 260 RYS-RSREREQNSYKNEREYRKYRETSK-------GRSRDRTERERSKETKIISSNNYNY 311 Query: 161 SEIRNTY 141 N Y Sbjct: 312 KNYNNNY 318 >AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 23.0 bits (47), Expect = 1.9 Identities = 21/67 (31%), Positives = 25/67 (37%) Frame = -2 Query: 341 KYSIRSTMRERQVCKAGNSIRPLRRVSREIPSMLSARSRARTEHHRVSPLRSTSRRVYPP 162 +YS RS RE+ K R R S+ RSR RTE R + S Y Sbjct: 271 RYS-RSREREQNSYKNEREYRKYRETSK-------GRSRDRTERERSKETKIISSNNYNY 322 Query: 161 SEIRNTY 141 N Y Sbjct: 323 KNYNNNY 329 >DQ325124-1|ABD14138.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.8 bits (44), Expect = 4.3 Identities = 9/31 (29%), Positives = 16/31 (51%) Frame = -1 Query: 93 NTKNY*SLHCGSF*RIL*KSPYQSKVVIRVP 1 N NY L+C ++ ++ Y ++ I VP Sbjct: 92 NNNNYKKLYCNNYKKLYYNINYIEQIPIPVP 122 >DQ325123-1|ABD14137.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.8 bits (44), Expect = 4.3 Identities = 9/31 (29%), Positives = 16/31 (51%) Frame = -1 Query: 93 NTKNY*SLHCGSF*RIL*KSPYQSKVVIRVP 1 N NY L+C ++ ++ Y ++ I VP Sbjct: 92 NNNNYKKLYCNNYKKLYYNINYIEQIPIPVP 122 >DQ325122-1|ABD14136.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.8 bits (44), Expect = 4.3 Identities = 9/31 (29%), Positives = 16/31 (51%) Frame = -1 Query: 93 NTKNY*SLHCGSF*RIL*KSPYQSKVVIRVP 1 N NY L+C ++ ++ Y ++ I VP Sbjct: 92 NNNNYKKLYCNNYRKLYYNINYIEQIPIPVP 122 >AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform A protein. Length = 782 Score = 21.8 bits (44), Expect = 4.3 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -3 Query: 370 KFSTVCRSRRNTLSAVRC 317 +F VCRSRR++ S C Sbjct: 341 QFLQVCRSRRHSDSCCLC 358 >AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. Length = 996 Score = 21.0 bits (42), Expect = 7.5 Identities = 7/36 (19%), Positives = 16/36 (44%) Frame = -3 Query: 337 TLSAVRCENVKCARPETAFVHYAAFPARSQVCFLPE 230 ++ A++ + C F H+ A P +V + + Sbjct: 180 SILAIKVYYISCPEISVNFAHFPATPTGREVALIEQ 215 >AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor type D2 protein. Length = 456 Score = 21.0 bits (42), Expect = 7.5 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = -2 Query: 71 FIVVLFKGFCRKVLISRK*LF 9 F+V L+ GFC + + K +F Sbjct: 352 FVVNLWSGFCSQCIWQEKIVF 372 >EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage protein protein. Length = 1010 Score = 20.6 bits (41), Expect = 10.0 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = -3 Query: 166 RQVRSAIRTRYLLGLT*PHQV 104 R V +AIR++ +T PHQ+ Sbjct: 598 RGVNAAIRSQEPFYITEPHQI 618 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 20.6 bits (41), Expect = 10.0 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = -2 Query: 224 ARTEHHRVSPLRSTSRRVYPPSE 156 A T + V+P SRR PP E Sbjct: 397 AATARNVVAPFLIGSRRTSPPPE 419 >AB022907-1|BAA86908.1| 615|Apis mellifera glucose oxidase protein. Length = 615 Score = 20.6 bits (41), Expect = 10.0 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = -2 Query: 230 SRARTEHHRVSPLRSTSRRVYPP 162 SR T++HR L + R Y P Sbjct: 199 SRVGTKYHRSGGLMNVERFPYQP 221 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 111,856 Number of Sequences: 438 Number of extensions: 2629 Number of successful extensions: 12 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14354847 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -