BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_F_B05 (818 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 24 1.7 AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor ... 23 2.2 X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. 23 3.9 AM292374-1|CAL23186.2| 659|Tribolium castaneum gustatory recept... 22 5.1 AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthol... 22 6.7 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 23.8 bits (49), Expect = 1.7 Identities = 11/37 (29%), Positives = 17/37 (45%) Frame = -2 Query: 283 ISELGHAYSISFKLLAVSWLYPWQW*AVCSSGQGQMK 173 ++ +G +FK L + W YP W + C G K Sbjct: 738 VAVVGFLRRHNFKGLHLDWNYPVCWQSNCKKGASSDK 774 >AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor protein protein. Length = 585 Score = 23.4 bits (48), Expect = 2.2 Identities = 6/15 (40%), Positives = 10/15 (66%) Frame = +3 Query: 174 FICPCPDEHTAHHCQ 218 + C CP +HT +C+ Sbjct: 439 YACYCPPKHTGKNCE 453 >X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. Length = 524 Score = 22.6 bits (46), Expect = 3.9 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = -3 Query: 570 YNHIKIHLMKQKKLSLFYC 514 +NH K+H+ + K+L+ C Sbjct: 218 WNHSKVHIREDKRLTCPKC 236 >AM292374-1|CAL23186.2| 659|Tribolium castaneum gustatory receptor candidate 53 protein. Length = 659 Score = 22.2 bits (45), Expect = 5.1 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = -3 Query: 117 LKLCTQLNNTLKVSVIFLLIT 55 L +C Q NT++ S IF L+T Sbjct: 284 LYICNQCYNTVEESRIFGLVT 304 >AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthologue protein. Length = 431 Score = 21.8 bits (44), Expect = 6.7 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = -3 Query: 294 CHSSSLNSDMRIVYHSN 244 CH SL+SD + + H N Sbjct: 334 CHPLSLSSDHQAMLHHN 350 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 186,510 Number of Sequences: 336 Number of extensions: 4012 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 22414104 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -