BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_F_B05 (818 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY578809-1|AAT07314.1| 358|Anopheles gambiae Sloan-Kettering In... 24 4.9 AY176048-1|AAO19579.1| 521|Anopheles gambiae cytochrome P450 CY... 24 6.5 >AY578809-1|AAT07314.1| 358|Anopheles gambiae Sloan-Kettering Institute proto-oncogeneproduct protein. Length = 358 Score = 24.2 bits (50), Expect = 4.9 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = +2 Query: 179 LPLPRRAYGSPLPGV 223 LP PR+ G P+PGV Sbjct: 87 LPQPRQPMGPPVPGV 101 >AY176048-1|AAO19579.1| 521|Anopheles gambiae cytochrome P450 CYP12F4 protein. Length = 521 Score = 23.8 bits (49), Expect = 6.5 Identities = 13/30 (43%), Positives = 15/30 (50%) Frame = +2 Query: 212 LPGVEPTYCQQFE*YTIRMSEFRDELWQSG 301 L G+ Q+ E Y R SEF E W SG Sbjct: 412 LVGMGQLVLQREEGYFTRPSEFMPERWLSG 441 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 777,031 Number of Sequences: 2352 Number of extensions: 15212 Number of successful extensions: 19 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 86902827 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -