BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_F_A24 (561 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_50705| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.091 SB_11363| Best HMM Match : Transposase_11 (HMM E-Value=2.3e-39) 31 0.64 SB_2102| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.4 SB_8363| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.5 SB_5387| Best HMM Match : DNA_pol_E_B (HMM E-Value=9.2e-35) 28 4.5 SB_53064| Best HMM Match : Hexapep (HMM E-Value=2.7e-07) 28 6.0 SB_37912| Best HMM Match : BTB (HMM E-Value=3.6e-13) 27 7.9 SB_8590| Best HMM Match : STAS (HMM E-Value=0.53) 27 7.9 >SB_50705| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 258 Score = 33.9 bits (74), Expect = 0.091 Identities = 19/69 (27%), Positives = 34/69 (49%), Gaps = 2/69 (2%) Frame = -2 Query: 389 ERREAKSDDTV*RQQVHLLGRRASHCLSGRALVFYE--YFRELVDKECSSQASDSFFQVR 216 E + + S DTV RQQ H + + C R +VF + + + + +CS F Q R Sbjct: 81 ETQCSDSRDTVFRQQRHSVHTAETQCSDSRDIVFRQQRHSVQTAETQCSDSRDTVFIQQR 140 Query: 215 HKLLRSQSR 189 H + ++++ Sbjct: 141 HSVYTAETQ 149 Score = 30.7 bits (66), Expect = 0.85 Identities = 18/63 (28%), Positives = 30/63 (47%), Gaps = 2/63 (3%) Frame = -2 Query: 371 SDDTV*RQQVHLLGRRASHCLSGRALVFYEYFREL--VDKECSSQASDSFFQVRHKLLRS 198 S DTV RQQ H + + C R +VF + + + +CS F Q RH + + Sbjct: 153 SRDTVFRQQRHSVQTAETQCSDSRDIVFRQQRHSVHTAETQCSYSRDTVFRQQRHSVQTA 212 Query: 197 QSR 189 +++ Sbjct: 213 ETQ 215 Score = 29.9 bits (64), Expect = 1.5 Identities = 19/69 (27%), Positives = 32/69 (46%), Gaps = 2/69 (2%) Frame = -2 Query: 389 ERREAKSDDTV*RQQVHLLGRRASHCLSGRALVFYEYFREL--VDKECSSQASDSFFQVR 216 E + + S DTV RQQ H + + C R VF + + + +CS F Q R Sbjct: 59 ETQCSDSRDTVFRQQRHSVQTAETQCSDSRDTVFRQQRHSVHTAETQCSDSRDIVFRQQR 118 Query: 215 HKLLRSQSR 189 H + ++++ Sbjct: 119 HSVQTAETQ 127 Score = 29.9 bits (64), Expect = 1.5 Identities = 18/57 (31%), Positives = 25/57 (43%), Gaps = 2/57 (3%) Frame = -2 Query: 371 SDDTV*RQQVHLLGRRASHCLSGRALVFYEYFREL--VDKECSSQASDSFFQVRHKL 207 S DTV RQQ H + + C R VF + + + +CS F Q RH + Sbjct: 197 SRDTVFRQQRHSVQTAETQCSDSRDTVFRQQRHSVHTAETQCSYSRDTVFIQQRHSV 253 Score = 28.3 bits (60), Expect = 4.5 Identities = 19/72 (26%), Positives = 34/72 (47%), Gaps = 2/72 (2%) Frame = -2 Query: 389 ERREAKSDDTV*RQQVHLLGRRASHCLSGRALVFYE--YFRELVDKECSSQASDSFFQVR 216 E + + S DTV QQ H + + CL R VF + + + + +CS F Q R Sbjct: 125 ETQCSDSRDTVFIQQRHSVYTAETQCLYSRDTVFRQQRHSVQTAETQCSDSRDIVFRQQR 184 Query: 215 HKLLRSQSRTGW 180 H + ++++ + Sbjct: 185 HSVHTAETQCSY 196 >SB_11363| Best HMM Match : Transposase_11 (HMM E-Value=2.3e-39) Length = 402 Score = 31.1 bits (67), Expect = 0.64 Identities = 19/54 (35%), Positives = 28/54 (51%) Frame = -2 Query: 353 RQQVHLLGRRASHCLSGRALVFYEYFRELVDKECSSQASDSFFQVRHKLLRSQS 192 R+Q L+ RAS L GR++ YE L ++CS +A D F +L S + Sbjct: 102 REQKRLMVLRASVALHGRSVTLYEKAFPL-SEQCSKKAHDQFLADLASILPSNT 154 >SB_2102| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2396 Score = 28.7 bits (61), Expect = 3.4 Identities = 14/30 (46%), Positives = 20/30 (66%), Gaps = 1/30 (3%) Frame = -1 Query: 414 VCTTPTNPRAQRSKVRRYSITS-AGPPFRK 328 V T+ NPR + S VRR +++S A PP +K Sbjct: 25 VITSRNNPRTRSSGVRRQNLSSLANPPHKK 54 >SB_8363| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 776 Score = 28.3 bits (60), Expect = 4.5 Identities = 12/30 (40%), Positives = 20/30 (66%) Frame = +1 Query: 364 SSDFASLRSRIGRCSANHLLPCYSQKTIDH 453 SSD A L + + CSA++ +PC + T+D+ Sbjct: 574 SSDSAFLEALVPLCSASNNVPCDLRNTLDY 603 >SB_5387| Best HMM Match : DNA_pol_E_B (HMM E-Value=9.2e-35) Length = 458 Score = 28.3 bits (60), Expect = 4.5 Identities = 10/23 (43%), Positives = 16/23 (69%) Frame = +2 Query: 221 PGKRNLMPGTNTPYPPVPENIRR 289 PG ++ PG P PP+PE++R+ Sbjct: 362 PGPQDPGPGNILPRPPIPESLRQ 384 >SB_53064| Best HMM Match : Hexapep (HMM E-Value=2.7e-07) Length = 585 Score = 27.9 bits (59), Expect = 6.0 Identities = 23/62 (37%), Positives = 28/62 (45%), Gaps = 7/62 (11%) Frame = +2 Query: 113 APLFPVAPIALQRVEVPVIQYNT-NQFSTVTE------EACAAPGKRNLMPGTNTPYPPV 271 AP VAP + E + NT ST+T E+ AAPG GTNTP + Sbjct: 262 APEITVAPGTTKASERTITSGNTLGSKSTITPGTTESPESTAAPGTTVSREGTNTPDSLL 321 Query: 272 PE 277 PE Sbjct: 322 PE 323 >SB_37912| Best HMM Match : BTB (HMM E-Value=3.6e-13) Length = 470 Score = 27.5 bits (58), Expect = 7.9 Identities = 17/38 (44%), Positives = 20/38 (52%) Frame = -1 Query: 408 TTPTNPRAQRSKVRRYSITSAGPPFRKTGKSLSLWKSS 295 T P+ PRA R+YS TS GP K K L + SS Sbjct: 399 TMPSEPRASPRMQRKYSPTS-GPSSYKQKKHLQVTLSS 435 >SB_8590| Best HMM Match : STAS (HMM E-Value=0.53) Length = 158 Score = 27.5 bits (58), Expect = 7.9 Identities = 12/37 (32%), Positives = 21/37 (56%) Frame = -3 Query: 262 IRSVRPRHQIPFSRCGTSFFGHSRELVGIVLDYRNLH 152 IRS RPR+QI GT + R+ G+ +++ ++ Sbjct: 64 IRSARPRYQILGQVPGTEIYRDIRQFPGLAKEFQRIN 100 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,700,814 Number of Sequences: 59808 Number of extensions: 381108 Number of successful extensions: 1107 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 1015 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1104 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1312894764 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -