BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_F_A23 (845 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept... 26 0.33 DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 prot... 21 9.3 >AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor candidate 46 protein. Length = 1451 Score = 26.2 bits (55), Expect = 0.33 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = -1 Query: 608 QSLTLQLLSAFAHAVRCLAFLGLPYGLINLFLVRVHF 498 Q + Q + F H+VR + FL +GL+NL +F Sbjct: 362 QYVMQQQVKNFRHSVRSVFFLSEIFGLVNLKYRETYF 398 >DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 protein. Length = 980 Score = 21.4 bits (43), Expect = 9.3 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -2 Query: 691 DDEDIVELPKPLPKDICE 638 DDED +E P P+ + E Sbjct: 479 DDEDAIEKPAPVKISVQE 496 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 192,846 Number of Sequences: 336 Number of extensions: 4009 Number of successful extensions: 13 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 23348025 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -