BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_F_A19 (465 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_06_0025 - 31110027-31110507,31111640-31111804,31113134-31113432 27 7.4 10_01_0007 - 79867-79950,80258-80303,80409-80641,80765-80836,811... 27 9.8 08_02_0903 + 22438406-22438614,22439640-22440366,22440494-224406... 27 9.8 05_01_0425 - 3347604-3347708,3348394-3348466,3349917-3350581,335... 27 9.8 >03_06_0025 - 31110027-31110507,31111640-31111804,31113134-31113432 Length = 314 Score = 27.1 bits (57), Expect = 7.4 Identities = 14/46 (30%), Positives = 22/46 (47%) Frame = +1 Query: 1 RPADDDSVLVLTRNKQHVQQIRRFLRSIGRVSGRSKP*GSAGTSSA 138 R +DD SV++ T QH F R +G + + G+A + A Sbjct: 173 RSSDDPSVVITTYEGQHCHHTASFQRGVGGAAVAAHIHGAAAVALA 218 >10_01_0007 - 79867-79950,80258-80303,80409-80641,80765-80836, 81135-81230,81506-81607,81684-82349 Length = 432 Score = 26.6 bits (56), Expect = 9.8 Identities = 15/34 (44%), Positives = 19/34 (55%) Frame = -3 Query: 286 LLFLTNVISCRGQRRVSDGNSSSSRGVWRYHGGY 185 LL L SC R S+ +SSSSR V R+ G+ Sbjct: 17 LLLLLVTCSCLSARERSNSSSSSSRRVVRHLPGF 50 >08_02_0903 + 22438406-22438614,22439640-22440366,22440494-22440679, 22441310-22441770,22441869-22442027,22442098-22442449, 22442563-22442842,22443330-22443661 Length = 901 Score = 26.6 bits (56), Expect = 9.8 Identities = 9/13 (69%), Positives = 11/13 (84%) Frame = -2 Query: 152 CMGEIAELVPALP 114 CMG++ EL PALP Sbjct: 752 CMGDVVELTPALP 764 >05_01_0425 - 3347604-3347708,3348394-3348466,3349917-3350581, 3350609-3351088,3351253-3351534 Length = 534 Score = 26.6 bits (56), Expect = 9.8 Identities = 16/42 (38%), Positives = 20/42 (47%) Frame = -3 Query: 283 LFLTNVISCRGQRRVSDGNSSSSRGVWRYHGGY*AGCINVVQ 158 LFL VISC G RV G + G ++GG G + Q Sbjct: 129 LFLF-VISCAGCNRVDGGGERAGAGGVGWNGGEAVGAVTAQQ 169 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,801,991 Number of Sequences: 37544 Number of extensions: 136846 Number of successful extensions: 393 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 391 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 393 length of database: 14,793,348 effective HSP length: 76 effective length of database: 11,940,004 effective search space used: 931320312 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -