BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_F_A15 (818 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF125547-1|ABL73931.1| 255|Tribolium castaneum obstractor D pro... 22 5.1 AM292370-1|CAL23182.1| 418|Tribolium castaneum gustatory recept... 22 5.1 AM292323-1|CAL23135.2| 587|Tribolium castaneum gustatory recept... 22 6.7 AM292353-1|CAL23165.2| 651|Tribolium castaneum gustatory recept... 21 8.9 >EF125547-1|ABL73931.1| 255|Tribolium castaneum obstractor D protein. Length = 255 Score = 22.2 bits (45), Expect = 5.1 Identities = 7/10 (70%), Positives = 8/10 (80%) Frame = +1 Query: 196 YGIFSHDKSC 225 YGIF H+ SC Sbjct: 103 YGIFGHETSC 112 >AM292370-1|CAL23182.1| 418|Tribolium castaneum gustatory receptor candidate 49 protein. Length = 418 Score = 22.2 bits (45), Expect = 5.1 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = -2 Query: 505 SKPPNYLILNFINNVSVLL 449 S PNYLIL+ NN ++L Sbjct: 14 STQPNYLILSNKNNTYLVL 32 >AM292323-1|CAL23135.2| 587|Tribolium castaneum gustatory receptor candidate 2 protein. Length = 587 Score = 21.8 bits (44), Expect = 6.7 Identities = 10/29 (34%), Positives = 16/29 (55%) Frame = -2 Query: 397 VGICVLSASFLTFSMSPTLALGALFTDIY 311 V +C+ A S+ P L L ++ T+IY Sbjct: 332 VCLCLFGAKVHDESIKPLLTLNSVPTEIY 360 >AM292353-1|CAL23165.2| 651|Tribolium castaneum gustatory receptor candidate 32 protein. Length = 651 Score = 21.4 bits (43), Expect = 8.9 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = -2 Query: 196 NFLMYTFRLLFVEIKSTFNLVKQ*VFIVLLLI 101 NF+ F++ F NL+ Q + V+LLI Sbjct: 359 NFVSTFFKIPFYSTLRPINLLVQIILDVILLI 390 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 191,604 Number of Sequences: 336 Number of extensions: 4426 Number of successful extensions: 6 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 22414104 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -