BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_F_A15 (818 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_14873| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.85 SB_12834| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.0 SB_56210| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.9 SB_52202| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.9 >SB_14873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 296 Score = 31.5 bits (68), Expect = 0.85 Identities = 16/58 (27%), Positives = 32/58 (55%), Gaps = 3/58 (5%) Frame = +2 Query: 554 YNVLFVCLLTKSPK-KRKCSFFSHRRFKS--LETVNLSNLFRESYDFINHLA*SKNNQ 718 + VL +L P+ +R+C F + + ++ ++ +FRE+ D +NH+A S N + Sbjct: 36 FPVLLGLVLNNYPRWRRRCRLFHKMKLDDSVVRSLRVAKVFRENSDNVNHMAFSANGE 93 >SB_12834| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1261 Score = 30.3 bits (65), Expect = 2.0 Identities = 11/22 (50%), Positives = 16/22 (72%) Frame = +3 Query: 549 FCITFCLFVS*QNPQRNGNVVS 614 FC+ +CLF+S + QRN N +S Sbjct: 1041 FCLVYCLFMSLRGTQRNSNELS 1062 >SB_56210| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 54 Score = 28.3 bits (60), Expect = 7.9 Identities = 9/31 (29%), Positives = 20/31 (64%) Frame = +1 Query: 724 FHPLFTKIIYKVVLLTYDTDVFYIELNXQKI 816 F+P+F ++IY + ++ + DV Y+ N ++ Sbjct: 7 FYPMFYRVIYPIFIIGFLPDVLYLPDNRVRV 37 >SB_52202| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 173 Score = 28.3 bits (60), Expect = 7.9 Identities = 9/31 (29%), Positives = 20/31 (64%) Frame = +1 Query: 724 FHPLFTKIIYKVVLLTYDTDVFYIELNXQKI 816 F+P+F ++IY + ++ + DV Y+ N ++ Sbjct: 64 FYPMFYRVIYPIFIIGFLPDVLYLPDNRVRV 94 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,281,280 Number of Sequences: 59808 Number of extensions: 474165 Number of successful extensions: 867 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 809 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 865 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2287608719 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -