BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_F_A12 (659 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPMIT.04 |cox3||cytochrome c oxidase 3|Schizosaccharomyces pombe... 163 2e-41 SPCC1753.01c |ssb2|SPCC584.06c, rpa2|single-stranded DNA binding... 26 5.5 SPBC29A3.10c |atp14||F1-ATPase subunit H |Schizosaccharomyces po... 25 7.3 >SPMIT.04 |cox3||cytochrome c oxidase 3|Schizosaccharomyces pombe|chr mitochondrial|||Manual Length = 273 Score = 163 bits (396), Expect = 2e-41 Identities = 84/196 (42%), Positives = 109/196 (55%), Gaps = 2/196 (1%) Frame = +1 Query: 73 RDISREGTYQGKHTILVNKGLR*GXXXXXXXXXXXXXXXXXXXXHRRLSPNIEIGRI*PP 252 RD+S E G HT V KGL+ G H LSP E+G + PP Sbjct: 69 RDMSTEANIHGAHTKAVTKGLKIGFMLFLISETFLFASIFWAFFHSSLSPTFELGAVWPP 128 Query: 253 SRITP--FNPFQIPLLNTIILIRSGVTVT*AHHSLIENNFSQTKQRLFLTILLGFYFTIL 426 I +P ++PLLNT+IL+ SG ++T AH+SLI N + L++TI L F F Sbjct: 129 VGIADKTIDPLEVPLLNTVILLTSGASLTYAHYSLIARNRENALKGLYMTIALSFLFLGG 188 Query: 427 QAYEYIEASFTIADRIYGSTFFIATGFHGIHVIIGTLFLLICYIRHLNNHFSKNHHFGFE 606 QAYEY A FTI+D +YG++F+ ATG HGIH+I+GT+ LL+ H + HH GFE Sbjct: 189 QAYEYWNAPFTISDSVYGASFYFATGLHGIHIIVGTILLLVATYNIYTYHLTNTHHNGFE 248 Query: 607 AAA*Y*HFVDVV*LFL 654 Y HF DVV LFL Sbjct: 249 CGIYYWHFCDVVWLFL 264 >SPCC1753.01c |ssb2|SPCC584.06c, rpa2|single-stranded DNA binding protein Ssb2|Schizosaccharomyces pombe|chr 3|||Manual Length = 279 Score = 25.8 bits (54), Expect = 5.5 Identities = 13/42 (30%), Positives = 22/42 (52%) Frame = +1 Query: 505 FHGIHVIIGTLFLLICYIRHLNNHFSKNHHFGFEAAA*Y*HF 630 + I + G +++ YIR + +H + HF EA A + HF Sbjct: 130 YGNIKIFSGKIYIASQYIRTIKDHNEVHFHF-LEAIAVHLHF 170 >SPBC29A3.10c |atp14||F1-ATPase subunit H |Schizosaccharomyces pombe|chr 2|||Manual Length = 103 Score = 25.4 bits (53), Expect = 7.3 Identities = 8/29 (27%), Positives = 19/29 (65%) Frame = +1 Query: 352 IENNFSQTKQRLFLTILLGFYFTILQAYE 438 + ++S T RL++ ++ G Y + L++Y+ Sbjct: 8 LSRSYSTTSPRLYVDVVQGLYISSLKSYK 36 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,013,453 Number of Sequences: 5004 Number of extensions: 35339 Number of successful extensions: 88 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 85 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 86 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 299817502 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -