BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_F_A09 (762 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock prote... 23 2.0 EF592538-1|ABQ95984.1| 582|Tribolium castaneum beta-N-acetylglu... 22 4.6 AM292326-1|CAL23138.2| 522|Tribolium castaneum gustatory recept... 21 8.1 >EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock protein 90 protein. Length = 721 Score = 23.4 bits (48), Expect = 2.0 Identities = 10/33 (30%), Positives = 18/33 (54%) Frame = +1 Query: 565 LPEDEEEYLTKEFSSVYEDAQCERLSNMTKNEL 663 LPEDEEE +E + C+ + ++ N++ Sbjct: 540 LPEDEEEKKKREEDKAKFEGLCKVMKSILDNKV 572 >EF592538-1|ABQ95984.1| 582|Tribolium castaneum beta-N-acetylglucosaminidase NAG3 protein. Length = 582 Score = 22.2 bits (45), Expect = 4.6 Identities = 9/33 (27%), Positives = 18/33 (54%) Frame = +1 Query: 583 EYLTKEFSSVYEDAQCERLSNMTKNELIQEYLL 681 +YL F + Y D + +R + +N+ +YL+ Sbjct: 26 KYLRTNFPNFYNDFEVQRYTWKCENQKCVKYLV 58 >AM292326-1|CAL23138.2| 522|Tribolium castaneum gustatory receptor candidate 5 protein. Length = 522 Score = 21.4 bits (43), Expect = 8.1 Identities = 16/50 (32%), Positives = 23/50 (46%), Gaps = 1/50 (2%) Frame = -2 Query: 149 FFSVNYRRTINTNSTLIYMTKKLQLNQQYEFFLSRSTLF-STARTTILFI 3 FF +N R + ++ +I + YE LS LF A T+LFI Sbjct: 311 FFELNRRTILGVSNAVITFLIVMVQKASYEK-LSPVVLFIQVAADTVLFI 359 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.314 0.130 0.374 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 158,033 Number of Sequences: 336 Number of extensions: 3240 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20442493 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (22.0 bits)
- SilkBase 1999-2023 -