BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_F_A03 (881 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF236124-1|AAF68382.1| 107|Anopheles gambiae thioredoxin 1 prot... 96 1e-21 >AF236124-1|AAF68382.1| 107|Anopheles gambiae thioredoxin 1 protein. Length = 107 Score = 96.3 bits (229), Expect = 1e-21 Identities = 42/92 (45%), Positives = 58/92 (63%) Frame = +1 Query: 130 IKDSDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXX 309 +KDS+D +L AGD+LVV+DF ATWCGPCK+I PKL+E + Sbjct: 5 VKDSEDFNNKLEAAGDQLVVVDFFATWCGPCKVIAPKLEEFQNKYADKIVVVKVDVDECE 64 Query: 310 XXASEYNINSMPTFVFVKNGKKLDEFSGANVD 405 A++YNI SMPTF+F+K + + +FSGAN + Sbjct: 65 ELAAQYNIASMPTFLFIKRKEVVGQFSGANAE 96 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 777,452 Number of Sequences: 2352 Number of extensions: 14051 Number of successful extensions: 19 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 94680279 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -