BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_F_A02 (334 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g60245.1 68416.m06733 60S ribosomal protein L37a (RPL37aC) 131 1e-31 At3g10950.1 68416.m01320 60S ribosomal protein L37a (RPL37aB) si... 124 1e-29 At2g32770.3 68415.m04011 purple acid phosphatase (PAP13) identic... 30 0.33 At2g32770.2 68415.m04012 purple acid phosphatase (PAP13) identic... 30 0.33 At2g32770.1 68415.m04010 purple acid phosphatase (PAP13) identic... 30 0.33 At4g28730.1 68417.m04109 glutaredoxin family protein contains gl... 27 2.4 At4g38600.2 68417.m05463 HECT-domain-containing protein / ubiqui... 27 4.1 At4g38600.1 68417.m05464 HECT-domain-containing protein / ubiqui... 27 4.1 At5g42580.1 68418.m05184 cytochrome P450 family protein similar ... 26 7.2 At2g15620.1 68415.m01789 ferredoxin--nitrite reductase, putative... 26 7.2 At5g58930.1 68418.m07382 expressed protein contains Pfam PF05340... 25 9.5 At3g18290.1 68416.m02326 zinc finger protein-related weak alignm... 25 9.5 At2g28650.1 68415.m03483 exocyst subunit EXO70 family protein co... 25 9.5 At1g42440.1 68414.m04894 expressed protein contains Pfam domain,... 25 9.5 >At3g60245.1 68416.m06733 60S ribosomal protein L37a (RPL37aC) Length = 92 Score = 131 bits (316), Expect = 1e-31 Identities = 57/88 (64%), Positives = 68/88 (77%) Frame = +1 Query: 37 MAKRTKKVGITGKYGTRYGASLRKMVKKMEVTQHAKYTCSFCGKDAMKRSCVGIWSCKRC 216 MAKRTKKVGI GKYGTRYGAS+RK +KKMEV+QH+KY C FCGK +KR VGIW CK C Sbjct: 1 MAKRTKKVGIVGKYGTRYGASIRKQIKKMEVSQHSKYFCEFCGKYGVKRKAVGIWGCKDC 60 Query: 217 KRTVXGGAWVFSTTAASSCRSAVRRLRE 300 + GGA+ +T +A + RS +RRLRE Sbjct: 61 GKVKAGGAYTMNTASAVTVRSTIRRLRE 88 >At3g10950.1 68416.m01320 60S ribosomal protein L37a (RPL37aB) similar to putative 60S ribosomal protein L37a GB:AAD28753 [Gossypium hirsutum] Length = 92 Score = 124 bits (299), Expect = 1e-29 Identities = 55/88 (62%), Positives = 65/88 (73%) Frame = +1 Query: 37 MAKRTKKVGITGKYGTRYGASLRKMVKKMEVTQHAKYTCSFCGKDAMKRSCVGIWSCKRC 216 M KRTKK I GKYGTRYGASLRK +KKMEV+QH KY C FCGK ++KR VGIW CK C Sbjct: 1 MTKRTKKARIVGKYGTRYGASLRKQIKKMEVSQHNKYFCEFCGKYSVKRKVVGIWGCKDC 60 Query: 217 KRTVXGGAWVFSTTAASSCRSAVRRLRE 300 + GGA+ +T +A + RS +RRLRE Sbjct: 61 GKVKAGGAYTMNTASAVTVRSTIRRLRE 88 >At2g32770.3 68415.m04011 purple acid phosphatase (PAP13) identical to purple acid phosphatase (PAP13) [Arabidopsis thaliana] GI:20257489; contains Pfam profile PF00149: Ser/Thr protein phosphatase Length = 545 Score = 30.3 bits (65), Expect = 0.33 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = +3 Query: 21 GEVYQNGQTYQKGWNYW 71 G Y +G+TYQ W+YW Sbjct: 261 GSCYSSGETYQPRWDYW 277 >At2g32770.2 68415.m04012 purple acid phosphatase (PAP13) identical to purple acid phosphatase (PAP13) [Arabidopsis thaliana] GI:20257489; contains Pfam profile PF00149: Ser/Thr protein phosphatase Length = 428 Score = 30.3 bits (65), Expect = 0.33 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = +3 Query: 21 GEVYQNGQTYQKGWNYW 71 G Y +G+TYQ W+YW Sbjct: 180 GSCYSSGETYQPRWDYW 196 >At2g32770.1 68415.m04010 purple acid phosphatase (PAP13) identical to purple acid phosphatase (PAP13) [Arabidopsis thaliana] GI:20257489; contains Pfam profile PF00149: Ser/Thr protein phosphatase Length = 516 Score = 30.3 bits (65), Expect = 0.33 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = +3 Query: 21 GEVYQNGQTYQKGWNYW 71 G Y +G+TYQ W+YW Sbjct: 261 GSCYSSGETYQPRWDYW 277 >At4g28730.1 68417.m04109 glutaredoxin family protein contains glutaredoxin domain, Pfam:PF00462 Length = 174 Score = 27.5 bits (58), Expect = 2.4 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = +1 Query: 67 TGKYGTRYGASLRKMVKKMEVTQHAKYTCSFC 162 + +G+R S+RK V + V ++K CS+C Sbjct: 62 SSSFGSRMEESIRKTVTENTVVIYSKTWCSYC 93 >At4g38600.2 68417.m05463 HECT-domain-containing protein / ubiquitin-transferase family protein similar to SP|Q14669Thyroid receptor interacting protein 12 (TRIP12) {Homo sapiens}; contains Pfam profile PF00632: HECT-domain (ubiquitin-transferase) Length = 1794 Score = 26.6 bits (56), Expect = 4.1 Identities = 10/22 (45%), Positives = 16/22 (72%) Frame = -3 Query: 242 QAPPXTVLLHRLQDQMPTQERF 177 + PP TVL+ +LQ+ + + ERF Sbjct: 802 KVPPMTVLIQKLQNALSSLERF 823 >At4g38600.1 68417.m05464 HECT-domain-containing protein / ubiquitin-transferase family protein similar to SP|Q14669Thyroid receptor interacting protein 12 (TRIP12) {Homo sapiens}; contains Pfam profile PF00632: HECT-domain (ubiquitin-transferase) Length = 1888 Score = 26.6 bits (56), Expect = 4.1 Identities = 10/22 (45%), Positives = 16/22 (72%) Frame = -3 Query: 242 QAPPXTVLLHRLQDQMPTQERF 177 + PP TVL+ +LQ+ + + ERF Sbjct: 875 KVPPMTVLIQKLQNALSSLERF 896 >At5g42580.1 68418.m05184 cytochrome P450 family protein similar to Cytochrome P450 93A1 (SP:Q42798) {Glycine max}; similar to flavone synthase II (GI:5081817) [Gerbera hybrida]. Length = 499 Score = 25.8 bits (54), Expect = 7.2 Identities = 23/96 (23%), Positives = 39/96 (40%), Gaps = 4/96 (4%) Frame = +1 Query: 16 VSERFTKMAKRTKKVG----ITGKYGTRYGASLRKMVKKMEVTQHAKYTCSFCGKDAMKR 183 VS RF + K + G +T YG Y ++K++ + HA + ++R Sbjct: 104 VSYRFVPVNKDSLVFGSSGFVTAPYGD-YWKFMKKLISTKLLRPHALELSKGNRAEELRR 162 Query: 184 SCVGIWSCKRCKRTVXGGAWVFSTTAASSCRSAVRR 291 C+ + R K +V G T CR ++ R Sbjct: 163 FCLDLQGKARKKESVEIGKVALKLTNNIICRMSMGR 198 >At2g15620.1 68415.m01789 ferredoxin--nitrite reductase, putative strong similarity to ferredoxin--nitrite reductase [Nicotiana tabacum] GI:19893; contains Pfam profiles PF03460: Nitrite/Sulfite reductase ferredoxin-like half domain, PF01077: Nitrite and sulphite reductase 4Fe-4S domain Length = 586 Score = 25.8 bits (54), Expect = 7.2 Identities = 10/37 (27%), Positives = 19/37 (51%) Frame = +1 Query: 193 GIWSCKRCKRTVXGGAWVFSTTAASSCRSAVRRLREV 303 G +S KRC+ + AWV + C++ + R++ Sbjct: 286 GFFSPKRCEEAIPLDAWVPADDVLPLCKAVLEAYRDL 322 >At5g58930.1 68418.m07382 expressed protein contains Pfam PF05340: Protein of unknown function (DUF740) Length = 521 Score = 25.4 bits (53), Expect = 9.5 Identities = 6/13 (46%), Positives = 11/13 (84%) Frame = +3 Query: 33 QNGQTYQKGWNYW 71 ++G+ + KGWN+W Sbjct: 347 KSGKNWSKGWNFW 359 >At3g18290.1 68416.m02326 zinc finger protein-related weak alignment to Pfam profiles: PF00097 Zinc finger, C3HC4 type (RING finger) (2 copies) Length = 1254 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/43 (27%), Positives = 20/43 (46%) Frame = -3 Query: 251 ENTQAPPXTVLLHRLQDQMPTQERFIASLPQNEQVYFACWVTS 123 E Q P + + ++Q RF+ S+P N F W++S Sbjct: 177 EQKQVFPLLIEKFKYEEQAYIVWRFLCSIPVNMLAVFLPWISS 219 >At2g28650.1 68415.m03483 exocyst subunit EXO70 family protein contains Pfam domain PF03081: Exo70 exocyst complex subunit Length = 573 Score = 25.4 bits (53), Expect = 9.5 Identities = 18/73 (24%), Positives = 39/73 (53%) Frame = -3 Query: 227 TVLLHRLQDQMPTQERFIASLPQNEQVYFACWVTSIFLTILRREAP*RVPYLPVIPTFLV 48 +++ H ++D R+I+ P++ C+++S+F T R EA + + + + ++ Sbjct: 27 SLMEHTIEDAESIIHRWIS--PEHVHSSSFCFISSLFSTENREEAKRFIDAVTTLHSGMI 84 Query: 47 RLAILVNLSDTKV 9 RL I VN + K+ Sbjct: 85 RL-ISVNPTSMKL 96 >At1g42440.1 68414.m04894 expressed protein contains Pfam domain, PF04950: Protein of unknown function (DUF663) Length = 793 Score = 25.4 bits (53), Expect = 9.5 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = +2 Query: 2 LCSLLYRRGLPKWP 43 +C LY+R PKWP Sbjct: 772 VCMNLYKRAYPKWP 785 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,629,844 Number of Sequences: 28952 Number of extensions: 151293 Number of successful extensions: 430 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 426 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 430 length of database: 12,070,560 effective HSP length: 71 effective length of database: 10,014,968 effective search space used: 390583752 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -