BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_P23 (404 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal... 24 2.4 AB090823-2|BAC57922.1| 1154|Anopheles gambiae reverse transcript... 23 3.2 AF492464-1|AAM11657.1| 803|Anopheles gambiae beta nu integrin s... 22 7.4 DQ004400-1|AAY21239.1| 144|Anopheles gambiae lysozyme c-5 protein. 22 9.8 AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcript... 22 9.8 AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcript... 22 9.8 >AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal growth factor receptorprotein. Length = 1433 Score = 23.8 bits (49), Expect = 2.4 Identities = 11/59 (18%), Positives = 27/59 (45%) Frame = -3 Query: 363 FISIYAPKMVAAKKQKKTIESINSRLALVMKSGKYCLGYKQTLKTLRQGKAKLVIIAKN 187 F S+Y K + K+++ +NS +++++ C +++ V++ KN Sbjct: 401 FASVYIVKTSLKSLELKSLKRVNSGSIVILENSDLCFVEDIDWSEIKKSSDHEVMVQKN 459 >AB090823-2|BAC57922.1| 1154|Anopheles gambiae reverse transcriptase protein. Length = 1154 Score = 23.4 bits (48), Expect = 3.2 Identities = 7/22 (31%), Positives = 17/22 (77%) Frame = -3 Query: 363 FISIYAPKMVAAKKQKKTIESI 298 FIS+YAP ++ ++ ++ +E++ Sbjct: 87 FISVYAPPSLSPQEYERLLEAV 108 >AF492464-1|AAM11657.1| 803|Anopheles gambiae beta nu integrin subunit AgBnu protein. Length = 803 Score = 22.2 bits (45), Expect = 7.4 Identities = 11/29 (37%), Positives = 18/29 (62%), Gaps = 2/29 (6%) Frame = -3 Query: 327 KKQKKTIESINSRLALVMK--SGKYCLGY 247 + K T+ES+ S+LAL + + Y LG+ Sbjct: 152 RDDKATLESMGSQLALALANLTANYQLGF 180 >DQ004400-1|AAY21239.1| 144|Anopheles gambiae lysozyme c-5 protein. Length = 144 Score = 21.8 bits (44), Expect = 9.8 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = -3 Query: 99 LGTACGKYYRVCTLA 55 LGT GK Y C LA Sbjct: 14 LGTCSGKIYNRCELA 28 >AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcriptase protein. Length = 1248 Score = 21.8 bits (44), Expect = 9.8 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = +2 Query: 29 CPSHQGSVMASVHTL*YFP 85 CP+ GSV + H L Y P Sbjct: 947 CPACTGSVESVAHVLFYCP 965 >AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcriptase protein. Length = 1201 Score = 21.8 bits (44), Expect = 9.8 Identities = 9/27 (33%), Positives = 17/27 (62%) Frame = -3 Query: 363 FISIYAPKMVAAKKQKKTIESINSRLA 283 FIS+YAP ++A + ++ + +I A Sbjct: 150 FISVYAPPSLSAHEFERLLGAIELEAA 176 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 418,183 Number of Sequences: 2352 Number of extensions: 7302 Number of successful extensions: 14 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 563,979 effective HSP length: 58 effective length of database: 427,563 effective search space used: 32494788 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -