BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_P22 (718 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY075249-1|AAL68116.1| 430|Drosophila melanogaster AT21437p pro... 29 8.4 AF125157-1|AAF20167.1| 420|Drosophila melanogaster tryptophanyl... 29 8.4 AF125156-1|AAF20166.1| 430|Drosophila melanogaster tryptophanyl... 29 8.4 AE014297-898|AAF54352.1| 430|Drosophila melanogaster CG9735-PB,... 29 8.4 AE014297-897|AAG22136.1| 430|Drosophila melanogaster CG9735-PA,... 29 8.4 >AY075249-1|AAL68116.1| 430|Drosophila melanogaster AT21437p protein. Length = 430 Score = 28.7 bits (61), Expect = 8.4 Identities = 14/35 (40%), Positives = 19/35 (54%) Frame = +3 Query: 510 LNKVFAFNQLELLSNCTSPQVNYVNILMIDKTLIF 614 +NK F FN LE + C + Y NI+ I K + F Sbjct: 190 VNKTFIFNNLEFVGKCPA---MYQNIIRIQKCVTF 221 >AF125157-1|AAF20167.1| 420|Drosophila melanogaster tryptophanyl-tRNA synthetase protein. Length = 420 Score = 28.7 bits (61), Expect = 8.4 Identities = 14/35 (40%), Positives = 19/35 (54%) Frame = +3 Query: 510 LNKVFAFNQLELLSNCTSPQVNYVNILMIDKTLIF 614 +NK F FN LE + C + Y NI+ I K + F Sbjct: 180 VNKTFIFNNLEFVGKCPA---MYQNIIRIQKCVTF 211 >AF125156-1|AAF20166.1| 430|Drosophila melanogaster tryptophanyl-tRNA synthetase protein. Length = 430 Score = 28.7 bits (61), Expect = 8.4 Identities = 14/35 (40%), Positives = 19/35 (54%) Frame = +3 Query: 510 LNKVFAFNQLELLSNCTSPQVNYVNILMIDKTLIF 614 +NK F FN LE + C + Y NI+ I K + F Sbjct: 190 VNKTFIFNNLEFVGKCPA---MYQNIIRIQKCVTF 221 >AE014297-898|AAF54352.1| 430|Drosophila melanogaster CG9735-PB, isoform B protein. Length = 430 Score = 28.7 bits (61), Expect = 8.4 Identities = 14/35 (40%), Positives = 19/35 (54%) Frame = +3 Query: 510 LNKVFAFNQLELLSNCTSPQVNYVNILMIDKTLIF 614 +NK F FN LE + C + Y NI+ I K + F Sbjct: 190 VNKTFIFNNLEFVGKCPA---MYQNIIRIQKCVTF 221 >AE014297-897|AAG22136.1| 430|Drosophila melanogaster CG9735-PA, isoform A protein. Length = 430 Score = 28.7 bits (61), Expect = 8.4 Identities = 14/35 (40%), Positives = 19/35 (54%) Frame = +3 Query: 510 LNKVFAFNQLELLSNCTSPQVNYVNILMIDKTLIF 614 +NK F FN LE + C + Y NI+ I K + F Sbjct: 190 VNKTFIFNNLEFVGKCPA---MYQNIIRIQKCVTF 221 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,639,758 Number of Sequences: 53049 Number of extensions: 430527 Number of successful extensions: 688 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 673 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 688 length of database: 24,988,368 effective HSP length: 83 effective length of database: 20,585,301 effective search space used: 3190721655 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -